Citrus Sinensis ID: 022346

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS
cccccccccHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccccccEEEEEEcccccHHHHHccccHHHHHHHcccccccccccccccccccEEEEEEcccEEEEEEEcccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccccccEEEEEEEccccHHHHHHHHHccccccccccEEEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccc
ccccccccEEEEEEccccccHHHEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccEEEEEEccccHHHHccccccHHHHHHHccccccccccHHcccccccEEEEEEccccEEEEEEccccccccccEEccccccccHHHcccccccccccHHcccHHHHHHHHHHHHHHHHHHHcccHHHccccEEEEEEEcccccccEEEEEEEEcccHHHHHHHHcccccccccccEEEEEHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccc
MEQEADSAYKLLLscphgfspsevsvvfdesydrvphpdnnlensISEIWDSRVQINKSLFngqkfrygghimrgeggssveSHVCLHlgltdyrtfvgtnlnplwekflvpseddviqcqhtasplgngavvetsdKKILLLQRsnnvgefpghfvfpgghpepqdagitshpcgstdsefinhKVSQEMFDSITREVVEEigvpseslcnplfigisrrrlnvrpAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENmaskmpgchqgGFALYKLMVEAMNNIPQNS
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHtasplgngavvETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEigvpseslcnPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS
********YKLLLSCPHGFSPSEVSVVFDESY***********NSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFP**********************FINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEA********
*****DS**KLLLSCPHGFSPSEVSVVFDESYDRVPHP**NLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDA******************VSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNE***********YESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMN******
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS
*****DSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
Q8VYR2311 Nudix hydrolase 9 OS=Arab yes no 0.979 0.938 0.647 1e-111
Q6P9U1308 Nucleoside diphosphate-li yes no 0.909 0.879 0.333 3e-33
Q2TBI8290 Nucleoside diphosphate-li yes no 0.859 0.882 0.330 9e-31
Q9DD16308 Nucleoside diphosphate-li yes no 0.852 0.824 0.322 4e-30
Q9BRQ3303 Nucleoside diphosphate-li yes no 0.906 0.891 0.334 1e-28
>sp|Q8VYR2|NUDT9_ARATH Nudix hydrolase 9 OS=Arabidopsis thaliana GN=NUDT9 PE=2 SV=1 Back     alignment and function desciption
 Score =  401 bits (1030), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/295 (64%), Positives = 236/295 (80%), Gaps = 3/295 (1%)

Query: 7   SAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKF 66
           S Y+LLLSCP G SPS+VSV F +S+DR+P  D  LE+SIS++W+ R Q N SLFNGQKF
Sbjct: 13  SRYQLLLSCPSGLSPSQVSVDFSKSHDRIPRQDPGLEDSISQVWEQRSQGNSSLFNGQKF 72

Query: 67  RYGGHIMRGEGGSSVE-SHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTAS 125
           RYGG+ +  + GS+ E  HVCL LGLTDYRTFVGTNL+ LWEKFLV SEDD ++C+HT+S
Sbjct: 73  RYGGYCLDDDDGSTNEVPHVCLRLGLTDYRTFVGTNLSSLWEKFLVTSEDDSVRCRHTSS 132

Query: 126 PLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGST--DSEFI 183
           PLGNGAV+ETSDKKI++L+RSNNVGEFPGH+VFPGGHPEP   GI  H   +     E +
Sbjct: 133 PLGNGAVIETSDKKIIVLRRSNNVGEFPGHYVFPGGHPEPTAVGIDYHQLENNVQTGEVL 192

Query: 184 NHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQ 243
           N KV+QEMFDSI  EVVEE G+P+ SL +PLFIGISRR LNVRPA FF++KCS  S++IQ
Sbjct: 193 NKKVTQEMFDSIICEVVEETGIPASSLSSPLFIGISRRELNVRPAMFFYLKCSHHSDDIQ 252

Query: 244 QLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS 298
           +LYS+A+DG+ESTQL  VS+ EL+ M S+MPGCH GGFALY+LM++ + N  + S
Sbjct: 253 RLYSSAEDGFESTQLHTVSLDELKMMTSRMPGCHHGGFALYELMLQRLKNTKETS 307
Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: -
>sp|Q6P9U1|NUD22_RAT Nucleoside diphosphate-linked moiety X motif 22 OS=Rattus norvegicus GN=Nudt22 PE=2 SV=1 Back     alignment and function description
>sp|Q2TBI8|NUD22_BOVIN Nucleoside diphosphate-linked moiety X motif 22 OS=Bos taurus GN=NUDT22 PE=2 SV=1 Back     alignment and function description
>sp|Q9DD16|NUD22_MOUSE Nucleoside diphosphate-linked moiety X motif 22 OS=Mus musculus GN=Nudt22 PE=2 SV=1 Back     alignment and function description
>sp|Q9BRQ3|NUD22_HUMAN Nucleoside diphosphate-linked moiety X motif 22 OS=Homo sapiens GN=NUDT22 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
224104499293 predicted protein [Populus trichocarpa] 0.956 0.972 0.777 1e-130
225435108301 PREDICTED: nudix hydrolase 9-like [Vitis 0.959 0.950 0.756 1e-128
297746149297 unnamed protein product [Vitis vinifera] 0.959 0.962 0.756 1e-127
356542603301 PREDICTED: nudix hydrolase 9-like [Glyci 0.973 0.963 0.710 1e-121
255637896301 unknown [Glycine max] 0.973 0.963 0.700 1e-119
449461013324 PREDICTED: nudix hydrolase 9-like, parti 0.983 0.904 0.685 1e-119
357472597303 Nudix hydrolase [Medicago truncatula] gi 0.953 0.937 0.725 1e-119
255587161306 Nudix hydrolase, putative [Ricinus commu 0.969 0.944 0.689 1e-118
356539080294 PREDICTED: LOW QUALITY PROTEIN: nudix hy 0.956 0.969 0.664 1e-110
22331623311 nudix hydrolase 9 [Arabidopsis thaliana] 0.979 0.938 0.647 1e-109
>gi|224104499|ref|XP_002313456.1| predicted protein [Populus trichocarpa] gi|222849864|gb|EEE87411.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/287 (77%), Positives = 249/287 (86%), Gaps = 2/287 (0%)

Query: 9   YKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRY 68
           Y+L+LSCP G SPS+VSVVFD SYDR+ HPD  LENSISEIWD RVQ N SLFNG+KFRY
Sbjct: 6   YELVLSCPSGLSPSQVSVVFDPSYDRIAHPDIELENSISEIWDQRVQKNASLFNGKKFRY 65

Query: 69  GGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLG 128
           GG+ +   GGS  + HVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDD++QCQHT+SPLG
Sbjct: 66  GGYTLCNRGGSQQDFHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDLMQCQHTSSPLG 125

Query: 129 NGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGS--TDSEFINHK 186
           NGA++ETSDKKI++LQRS NVGEFPGH VFPGGHPEP++ G  SH  G   T+ E  N K
Sbjct: 126 NGAILETSDKKIVVLQRSYNVGEFPGHVVFPGGHPEPEEVGAASHQMGERLTNLEHNNTK 185

Query: 187 VSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLY 246
           VSQEMFDSI REVVEEIGVP  SLCNPLFIGISRR LNVRPAAFFFIKC+++S EIQ+LY
Sbjct: 186 VSQEMFDSIIREVVEEIGVPVTSLCNPLFIGISRRVLNVRPAAFFFIKCNIESKEIQRLY 245

Query: 247 STAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNN 293
           + AQDGYESTQL+ VS+IELENMASKMPGCHQGGFALYKLM+EAM N
Sbjct: 246 AGAQDGYESTQLYTVSLIELENMASKMPGCHQGGFALYKLMLEAMKN 292

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225435108|ref|XP_002284515.1| PREDICTED: nudix hydrolase 9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297746149|emb|CBI16205.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356542603|ref|XP_003539756.1| PREDICTED: nudix hydrolase 9-like [Glycine max] Back     alignment and taxonomy information
>gi|255637896|gb|ACU19266.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449461013|ref|XP_004148238.1| PREDICTED: nudix hydrolase 9-like, partial [Cucumis sativus] gi|449484992|ref|XP_004157039.1| PREDICTED: nudix hydrolase 9-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|357472597|ref|XP_003606583.1| Nudix hydrolase [Medicago truncatula] gi|355507638|gb|AES88780.1| Nudix hydrolase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255587161|ref|XP_002534161.1| Nudix hydrolase, putative [Ricinus communis] gi|223525765|gb|EEF28221.1| Nudix hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356539080|ref|XP_003538028.1| PREDICTED: LOW QUALITY PROTEIN: nudix hydrolase 9-like [Glycine max] Back     alignment and taxonomy information
>gi|22331623|ref|NP_190206.2| nudix hydrolase 9 [Arabidopsis thaliana] gi|68565917|sp|Q8VYR2.1|NUDT9_ARATH RecName: Full=Nudix hydrolase 9; Short=AtNUDT9 gi|17979155|gb|AAL49773.1| unknown protein [Arabidopsis thaliana] gi|21436455|gb|AAM51428.1| unknown protein [Arabidopsis thaliana] gi|332644606|gb|AEE78127.1| nudix hydrolase 9 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
TAIR|locus:2075336311 NUDT9 "nudix hydrolase homolog 0.979 0.938 0.647 9.8e-103
RGD|735224308 Nudt22 "nudix (nucleoside diph 0.906 0.876 0.342 4.1e-33
UNIPROTKB|Q9BRQ3303 NUDT22 "Nucleoside diphosphate 0.902 0.887 0.329 1.8e-32
MGI|MGI:1915573308 Nudt22 "nudix (nucleoside diph 0.895 0.866 0.339 4.7e-32
UNIPROTKB|F1RQ03290 NUDT22 "Uncharacterized protei 0.832 0.855 0.340 6e-32
UNIPROTKB|E2RP80403 NUDT22 "Uncharacterized protei 0.865 0.640 0.326 9.8e-32
UNIPROTKB|Q2TBI8290 NUDT22 "Nucleoside diphosphate 0.855 0.879 0.333 1.1e-30
ZFIN|ZDB-GENE-041010-171331 nudt22 "nudix (nucleoside diph 0.687 0.619 0.336 5.3e-30
TAIR|locus:2075336 NUDT9 "nudix hydrolase homolog 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1018 (363.4 bits), Expect = 9.8e-103, P = 9.8e-103
 Identities = 191/295 (64%), Positives = 236/295 (80%)

Query:     7 SAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKF 66
             S Y+LLLSCP G SPS+VSV F +S+DR+P  D  LE+SIS++W+ R Q N SLFNGQKF
Sbjct:    13 SRYQLLLSCPSGLSPSQVSVDFSKSHDRIPRQDPGLEDSISQVWEQRSQGNSSLFNGQKF 72

Query:    67 RYGGHIMRGEGGSSVE-SHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTAS 125
             RYGG+ +  + GS+ E  HVCL LGLTDYRTFVGTNL+ LWEKFLV SEDD ++C+HT+S
Sbjct:    73 RYGGYCLDDDDGSTNEVPHVCLRLGLTDYRTFVGTNLSSLWEKFLVTSEDDSVRCRHTSS 132

Query:   126 PLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGST--DSEFI 183
             PLGNGAV+ETSDKKI++L+RSNNVGEFPGH+VFPGGHPEP   GI  H   +     E +
Sbjct:   133 PLGNGAVIETSDKKIIVLRRSNNVGEFPGHYVFPGGHPEPTAVGIDYHQLENNVQTGEVL 192

Query:   184 NHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQ 243
             N KV+QEMFDSI  EVVEE G+P+ SL +PLFIGISRR LNVRPA FF++KCS  S++IQ
Sbjct:   193 NKKVTQEMFDSIICEVVEETGIPASSLSSPLFIGISRRELNVRPAMFFYLKCSHHSDDIQ 252

Query:   244 QLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYKLMVEAMNNIPQNS 298
             +LYS+A+DG+ESTQL  VS+ EL+ M S+MPGCH GGFALY+LM++ + N  + S
Sbjct:   253 RLYSSAEDGFESTQLHTVSLDELKMMTSRMPGCHHGGFALYELMLQRLKNTKETS 307
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=RCA
RGD|735224 Nudt22 "nudix (nucleoside diphosphate linked moiety X)-type motif 22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BRQ3 NUDT22 "Nucleoside diphosphate-linked moiety X motif 22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915573 Nudt22 "nudix (nucleoside diphosphate linked moiety X)-type motif 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQ03 NUDT22 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RP80 NUDT22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBI8 NUDT22 "Nucleoside diphosphate-linked moiety X motif 22" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-171 nudt22 "nudix (nucleoside diphosphate linked moiety X)-type motif 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9BRQ3NUD22_HUMANNo assigned EC number0.33440.90600.8910yesno
Q2TBI8NUD22_BOVINNo assigned EC number0.33080.85900.8827yesno
Q6P9U1NUD22_RATNo assigned EC number0.33330.90930.8798yesno
Q9DD16NUD22_MOUSENo assigned EC number0.32240.85230.8246yesno
Q8VYR2NUDT9_ARATH3, ., 6, ., 1, ., -0.64740.97980.9389yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_IX001300
hypothetical protein (293 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 2e-07
pfam00293133 pfam00293, NUDIX, NUDIX domain 3e-05
cd04694143 cd04694, Nudix_Hydrolase_35, Members of the Nudix 2e-04
cd03426157 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse) 2e-04
cd04670127 cd04670, Nudix_Hydrolase_12, Members of the Nudix 6e-04
cd04682122 cd04682, Nudix_Hydrolase_23, Members of the Nudix 6e-04
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information 
 Score = 48.7 bits (116), Expect = 2e-07
 Identities = 24/106 (22%), Positives = 40/106 (37%), Gaps = 25/106 (23%)

Query: 127 LGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHK 186
           +  GAV+   D ++LL++R+++     G +  PGG  EP          G T        
Sbjct: 1   VAVGAVILDEDGRVLLVRRADS---PGGLWELPGGGVEP----------GET-------- 39

Query: 187 VSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFF 232
               + ++  REV EE G+  + L       +           F F
Sbjct: 40  ----LEEAAIREVREETGLDVDVLRLLGVYEVESPDEGEHAVVFVF 81

Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase. Length = 123
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|240050 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239518 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.78
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.78
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.76
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.76
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.76
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.76
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.75
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.74
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.74
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.74
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.74
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.74
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.73
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.73
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.73
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.73
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.73
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.73
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.72
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.72
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.72
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.72
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.72
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.71
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.71
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.71
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.71
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.7
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.7
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.7
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.7
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.69
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.69
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.69
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.69
PLN02325144 nudix hydrolase 99.69
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.68
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.68
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.68
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.67
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.67
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.67
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.67
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.66
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.66
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.66
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.66
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.66
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.65
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.65
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.65
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.65
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.64
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.63
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.63
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.63
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.62
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.62
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.61
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.61
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.57
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.57
PRK10707190 putative NUDIX hydrolase; Provisional 99.57
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.56
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.56
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.56
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 99.56
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.53
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.53
PLN02709222 nudix hydrolase 99.52
PRK08999 312 hypothetical protein; Provisional 99.5
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.47
PLN03143291 nudix hydrolase; Provisional 99.43
PLN02552247 isopentenyl-diphosphate delta-isomerase 99.41
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.37
PRK10880350 adenine DNA glycosylase; Provisional 99.37
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.36
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.36
PLN02791 770 Nudix hydrolase homolog 99.33
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 99.27
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 99.23
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 99.21
COG1194342 MutY A/G-specific DNA glycosylase [DNA replication 99.18
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 99.17
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 99.15
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 99.07
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 99.0
TIGR01084275 mutY A/G-specific adenine glycosylase. This equiva 98.97
PRK13910289 DNA glycosylase MutY; Provisional 98.96
KOG2457555 consensus A/G-specific adenine DNA glycosylase [Re 98.89
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 98.8
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 98.76
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 98.75
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 98.74
PLN02839372 nudix hydrolase 98.55
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 98.47
KOG0142225 consensus Isopentenyl pyrophosphate:dimethylallyl 97.39
COG4112203 Predicted phosphoesterase (MutT family) [General f 97.24
KOG4195275 consensus Transient receptor potential-related cha 96.92
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 96.91
KOG4313306 consensus Thiamine pyrophosphokinase [Nucleotide t 95.57
KOG2937 348 consensus Decapping enzyme complex, predicted pyro 93.92
PRK10702211 endonuclease III; Provisional 91.39
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 89.12
TIGR01083191 nth endonuclease III. This equivalog model identif 84.69
PF14443126 DBC1: DBC1 83.36
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 81.17
KOG4432405 consensus Uncharacterized NUDIX family hydrolase [ 81.15
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information 
Probab=99.78  E-value=1.3e-18  Score=143.57  Aligned_cols=113  Identities=19%  Similarity=0.204  Sum_probs=82.9

Q ss_pred             CcccEEEEEeCCCeEEEEEecCCCCCCCCcEEcCCcccCCCCCCCCCCCCCCCchhhhhhhhhhhHHHHHHHhhhhhhCC
Q 022346          126 PLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGV  205 (298)
Q Consensus       126 ~~gV~~vl~~~dg~vLl~rRs~~~~~~~g~w~~PGG~vE~~E~~~~~~~~~~~~~~~~~~~~~~~l~~aa~REl~EEtGl  205 (298)
                      .++|+++|++.+|+|||+||...  .++|+|.+|||++|+||+                      +.+||+||++||||+
T Consensus        12 ~v~v~~vI~~~~g~vLl~~R~~~--p~~g~w~lPGG~ve~gEs----------------------~~~aa~RE~~EE~Gl   67 (144)
T cd03430          12 LVSIDLIVENEDGQYLLGKRTNR--PAQGYWFVPGGRIRKNET----------------------LTEAFERIAKDELGL   67 (144)
T ss_pred             eEEEEEEEEeCCCeEEEEEccCC--CCCCcEECCCceecCCCC----------------------HHHHHHHHHHHHHCC
Confidence            56788889888899999999864  568999999999999998                      579999999999999


Q ss_pred             CCCCCCCCeeEEeecccc------cC--CceEEEEEEecCChhhHHhhhccCCCCCcccceEEEcHHHHhch
Q 022346          206 PSESLCNPLFIGISRRRL------NV--RPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENM  269 (298)
Q Consensus       206 ~~~~~~~p~~l~~~~~~~------~~--~~~~~~~~~~~~~~~ev~~~~~~~~d~~E~~~~~wv~~~el~~l  269 (298)
                      .+.... ..++++..+.+      ..  .....+++.|....+++.      ....|..++.|++++++.++
T Consensus        68 ~v~~~~-~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~e~~~~~W~~~~el~~~  132 (144)
T cd03430          68 EFLISD-AELLGVFEHFYDDNFFGDDFSTHYVVLGYVLKLSSNELL------LPDEQHSEYQWLTSDELLAD  132 (144)
T ss_pred             Cccccc-ceEEEEEEEEeccccccCCCccEEEEEEEEEEEcCCccc------CCchhccEeEEecHHHHhcC
Confidence            886541 12666543211      11  122233455544444432      34668999999999999965

This class of enzymes is unique from other members of the superfamily in two aspects. First, it contains a modified Nudix signature sequence. The slight changes to the conserved sequence motif, GX5EX7REUXEEXGU, where U = I, L or V), are believed to contribute to the removal of all magnesium binding sites but one, retaining only the metal site that coordinates the pyrophosphate of the substrate. Secondly, it is not a pyrophosphatase that substitutes at a phosphorus; instead, it hydrolyzes nucleotide sugars such as GDP-mannose to GDP and mannose, cleaving the phosphoglycosyl bond by substituting at a carbon position. GDP-mannose provides mannosyl components for cell wall synthesis and is required for the synthesis of other glycosyl donors (such as GDP-fucose and colitose) for the cell wall. The importance of GDP-sugar hydrolase activities is thus close
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>KOG2457 consensus A/G-specific adenine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] Back     alignment and domain information
>PRK10702 endonuclease III; Provisional Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>TIGR01083 nth endonuclease III Back     alignment and domain information
>PF14443 DBC1: DBC1 Back     alignment and domain information
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 9e-07
3grn_A153 MUTT related protein; structural genomics, hydrola 2e-05
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 1e-04
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 2e-04
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 4e-04
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 4e-04
3exq_A161 Nudix family hydrolase; protein structure initiati 7e-04
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 50.6 bits (120), Expect = 3e-07
 Identities = 42/303 (13%), Positives = 93/303 (30%), Gaps = 67/303 (22%)

Query: 1   MEQEADSAYKLLLSCPHGFS--PSEVSVVFDESYDRV-----PHPDNNLENSISEIWDSR 53
           +E+     YK L+S        PS ++ ++ E  DR+          N+ + +       
Sbjct: 83  VEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNV-SRLQPYL--- 138

Query: 54  VQINKSLFNGQKFRY-GGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKF-LV 111
            ++ ++L   +  +      + G G + V   VCL      Y+     +    W      
Sbjct: 139 -KLRQALLELRPAKNVLIDGVLGSGKTWVALDVCL-----SYKVQCKMDFKIFWLNLKNC 192

Query: 112 PSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEP------ 165
            S + V++         +      SD    +  R +++       +    +         
Sbjct: 193 NSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN 252

Query: 166 -QDAG------------ITSHPCGSTD---SEFINHKVSQEMFDSITREVVEEI-----G 204
            Q+A             +T+     TD   +    H        ++T + V+ +      
Sbjct: 253 VQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLD 312

Query: 205 VPSESL------CNPLFIGISRRRLNVRPAAF-FF-----------IKCS---LQSNEIQ 243
              + L       NP  + I    +    A +  +           I+ S   L+  E +
Sbjct: 313 CRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYR 372

Query: 244 QLY 246
           +++
Sbjct: 373 KMF 375
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Length = 232 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.85
3grn_A153 MUTT related protein; structural genomics, hydrola 99.81
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.78
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.78
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.77
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.77
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.77
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.77
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.76
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.75
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.75
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.75
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.75
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.74
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.74
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.74
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.73
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.73
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.73
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.73
3exq_A161 Nudix family hydrolase; protein structure initiati 99.72
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.72
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.72
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.71
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.71
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.71
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.71
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.71
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.71
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.7
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.69
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.69
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.68
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.68
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.67
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.67
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.67
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.67
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.67
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.67
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.66
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.66
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.66
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.65
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.65
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.65
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.65
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.64
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.63
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.63
2fb1_A226 Conserved hypothetical protein; structural genomic 99.62
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.62
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.62
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.61
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.61
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.6
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.59
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.59
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.59
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.59
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.58
3f13_A163 Putative nudix hydrolase family member; structural 99.57
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.57
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.56
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.54
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 99.53
2fml_A273 MUTT/nudix family protein; structural genomics, PS 99.52
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.52
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.49
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.44
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 99.43
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 99.38
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 99.25
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 99.09
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 99.09
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.9
3bho_A208 Cleavage and polyadenylation specificity factor su 98.46
3n5n_X287 A/G-specific adenine DNA glycosylase; alpha-helice 95.28
1kea_A221 Possible G-T mismatches repair enzyme; DNA repair, 94.94
1kg2_A225 A/G-specific adenine glycosylase; DNA repair, hydr 92.86
2abk_A211 Endonuclease III; DNA-repair, DNA glycosylase; 1.8 92.73
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4F 89.1
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
Probab=99.85  E-value=4.9e-23  Score=193.46  Aligned_cols=207  Identities=15%  Similarity=0.166  Sum_probs=144.2

Q ss_pred             CCCCCCceEEEeccCCCCCCCCCcchhhHHHHHHHHHHhhCcCC-c--CCcceeeeceEeecCCCCCCcceEEEEecCcc
Q 022346           17 HGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSL-F--NGQKFRYGGHIMRGEGGSSVESHVCLHLGLTD   93 (298)
Q Consensus        17 ~g~~~~~v~~~~s~~f~~~p~p~~~~~~~I~~~w~~~~~~~p~l-f--ng~~f~~~~~~~~~~~~~~~~~~~~l~lg~T~   93 (298)
                      ||||+.|++++++-+|++ |.+.  +|.+|.|+..++..-.... +  +-..++.....+.+.+...+++++.|++|.+ 
T Consensus       124 ~GIG~~tA~~il~~~~~~-~~~~--vD~~v~Rv~~rl~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~l~~~G~~-  199 (369)
T 3fsp_A          124 KGVGPYTVGAVLSLAYGV-PEPA--VDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGAL-  199 (369)
T ss_dssp             TTCCHHHHHHHHHHHHCC-CCCC--CCHHHHHHHHHHTTCCSCTTSHHHHHHHHHHHHHHCCSSSHHHHHHHHHHHHHH-
T ss_pred             CCcCHHHHHHHHHHHCCC-Cccc--ccHHHHHHHHHHcCcccCccccchHHHHHHHHHHhCChhhHHHHHHHHHHHHHH-
Confidence            899999999999999999 7654  8999999998875421111 1  1112322222333344566789999999999 


Q ss_pred             cccccccCCCcchhhcc----CCCCchh------hhhccc--cCCcccEEEEEeCCCeEEEEEecCCCCCCCCcEEcCCc
Q 022346           94 YRTFVGTNLNPLWEKFL----VPSEDDV------IQCQHT--ASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGG  161 (298)
Q Consensus        94 yr~~v~T~~~p~~~~~~----~~~~~~~------~~~~~~--~~~~gV~~vl~~~dg~vLl~rRs~~~~~~~g~w~~PGG  161 (298)
                          +||+.+|.|..|.    |......      .+....  .....++++|.+.+|+|||+||... +.++|+|+||||
T Consensus       200 ----~C~~~~P~C~~Cpl~~~C~~~~~~~~~~~PvK~~kk~~~~~~~~~~vi~~~~g~vLL~rR~~~-g~~~GlWefPGG  274 (369)
T 3fsp_A          200 ----VCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDST-GLLANLWEFPSC  274 (369)
T ss_dssp             ----TSCSSSCCTTTCTTGGGCHHHHHTCGGGCSCCCCCCCCEEEEEEEEEEECSSSEEEEEECCSS-STTTTCEECCEE
T ss_pred             ----hcCCCCCCCCCCCChhhhHHHhcCCcccCCccccccCcceEEEEEEEEEeCCCEEEEEECCCC-CCcCCcccCCCc
Confidence                9999999998773    2221111      111111  1122345666678899999999875 579999999999


Q ss_pred             ccCCCCCCCCCCCCCCCchhhhhhhhhhhHHHHHHHhhhhhhCCCCCCCCCCeeEEeecccccCCceEEEEEEecCChhh
Q 022346          162 HPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNE  241 (298)
Q Consensus       162 ~vE~~E~~~~~~~~~~~~~~~~~~~~~~~l~~aa~REl~EEtGl~~~~~~~p~~l~~~~~~~~~~~~~~~~~~~~~~~~e  241 (298)
                      ++|+| ++                      .++++||+.||||+.+....   +++...+.++++....+++.+....+ 
T Consensus       275 ~ve~g-t~----------------------~~al~REl~EE~Gl~v~~~~---~l~~~~h~~~h~~~~~~~~~~~~~~~-  327 (369)
T 3fsp_A          275 ETDGA-DG----------------------KEKLEQMVGEQYGLQVELTE---PIVSFEHAFSHLVWQLTVFPGRLVHG-  327 (369)
T ss_dssp             ECSSS-CT----------------------HHHHHHHHTTSSSCCEEECC---CCCEEEEECSSEEEEEEEEEEEECCS-
T ss_pred             ccCCC-Cc----------------------HHHHHHHHHHHhCCceeeec---ccccEEEEcceEEEEEEEEEEEEcCC-
Confidence            99999 74                      69999999999999987665   55555555555444445555543321 


Q ss_pred             HHhhhccCCCCCcccceEEEcHHHHhch
Q 022346          242 IQQLYSTAQDGYESTQLFAVSMIELENM  269 (298)
Q Consensus       242 v~~~~~~~~d~~E~~~~~wv~~~el~~l  269 (298)
                                ..|..++.|++++++.++
T Consensus       328 ----------~~e~~~~~Wv~~~el~~~  345 (369)
T 3fsp_A          328 ----------GPVEEPYRLAPEDELKAY  345 (369)
T ss_dssp             ----------SCCCTTEEEEEGGGGGGS
T ss_pred             ----------CCCccccEEeeHHHhhhC
Confidence                      347789999999999875
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens} Back     alignment and structure
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 Back     alignment and structure
>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Back     alignment and structure
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Back     alignment and structure
>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d1nqza_187 d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco 2e-05
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 2e-04
d1xsba_153 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 0.002
d1irya_156 d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha 0.002
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 0.003
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Coenzyme A pyrophosphatase
species: Deinococcus radiodurans [TaxId: 1299]

 Score = 42.1 bits (98), Expect = 2e-05
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 131 AVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQD 167
           A+   +D ++LL  RS+ +    G   FPGG  +  +
Sbjct: 38  ALTREADPRVLLTVRSSELPTHKGQIAFPGGSLDAGE 74
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.81
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.81
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.78
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.76
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.76
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.76
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.75
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.75
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.72
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.72
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.72
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.71
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.71
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.7
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.7
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.7
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.69
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.68
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.66
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.64
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.63
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 99.62
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.6
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.59
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.59
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.57
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 99.36
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 99.34
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 99.25
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 99.09
d1keaa_217 Thymine-DNA glycosylase {Archaeon Methanobacterium 97.05
d1rrqa1221 Catalytic domain of MutY {Bacillus stearothermophi 97.03
d2abka_211 Endonuclease III {Escherichia coli [TaxId: 562]} 96.99
d1kg2a_224 Catalytic domain of MutY {Escherichia coli [TaxId: 96.34
d1orna_214 Endonuclease III {Escherichia coli [TaxId: 562]} 96.2
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: IPP isomerase-like
domain: Hypothetical protein YfcD
species: Escherichia coli [TaxId: 562]

Probab=99.81  E-value=4.1e-20  Score=151.94  Aligned_cols=127  Identities=17%  Similarity=0.188  Sum_probs=91.8

Q ss_pred             cccEEEEEeCCCeEEEEEecCCCCCCCCcEEcC-CcccCCCCCCCCCCCCCCCchhhhhhhhhhhHHHHHHHhhhhhhCC
Q 022346          127 LGNGAVVETSDKKILLLQRSNNVGEFPGHFVFP-GGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGV  205 (298)
Q Consensus       127 ~gV~~vl~~~dg~vLl~rRs~~~~~~~g~w~~P-GG~vE~~E~~~~~~~~~~~~~~~~~~~~~~~l~~aa~REl~EEtGl  205 (298)
                      .+|.+++++.+|+|||+||+.....+||+|++| ||++++||+                      +.+||+||++|||||
T Consensus        31 ~~v~v~v~~~~g~vLl~rR~~~~~~~pg~w~~~~GG~ie~gEs----------------------~~~aa~REl~EE~Gi   88 (161)
T d2fkba1          31 RATYIVVHDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQ----------------------LLESARREAEEELGI   88 (161)
T ss_dssp             EEEEEEEECSSSCEEEEEECSSCSSSTTCEESSBCCBCBTTCC----------------------HHHHHHHHHHHHHCC
T ss_pred             eEEEEEEEeCCCCEEEEEecCccccccccccccccccccccCc----------------------HHHHHHHHHHHHhCC
Confidence            367788889999999999998877899999986 999999998                      579999999999999


Q ss_pred             CCCCCCCCeeEEeecccccCCceEEEEEEecCChhhHHhhhccCCCCCcccceEEEcHHHHhchhccCCCCchhHHHHHH
Q 022346          206 PSESLCNPLFIGISRRRLNVRPAAFFFIKCSLQSNEIQQLYSTAQDGYESTQLFAVSMIELENMASKMPGCHQGGFALYK  285 (298)
Q Consensus       206 ~~~~~~~p~~l~~~~~~~~~~~~~~~~~~~~~~~~ev~~~~~~~~d~~E~~~~~wv~~~el~~l~~~~~~~~~g~~~~y~  285 (298)
                      ....+.   .++.............+++.+. ..+++.      ++..|+.++.|++++|+.++...+.+....++.+|.
T Consensus        89 ~~~~~~---~~~~~~~~~~~~~~~~~~~~~~-~~~~~~------~~~~Ev~~~~w~~~~el~~~~~~~~P~~~~al~~~~  158 (161)
T d2fkba1          89 AGVPFA---EHGQFYFEDKNCRVWGALFSCV-SHGPFA------LQEDEVSEVCWLTPEEITARCDEFTPDSLKALALWM  158 (161)
T ss_dssp             BSCCCE---EEEEEEEEETTEEEEEEEEEEE-CCCCCC------CCTTTEEEEEEECHHHHHTTGGGBCHHHHHHHHHHH
T ss_pred             ccceeE---EEEEEEeecCCcEEEEEEEEEE-ECCCCc------CChhHeeEEEEEeHHHHhhhhhccCCcHHHHHHHHH
Confidence            876655   4544322222222222233332 223333      567799999999999999887666554444555553
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} Back     information, alignment and structure
>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure