Citrus Sinensis ID: 022348
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 298 | ||||||
| 255584279 | 309 | 2-deoxyglucose-6-phosphate phosphatase, | 0.922 | 0.889 | 0.719 | 1e-117 | |
| 297802106 | 314 | hypothetical protein ARALYDRAFT_912489 [ | 0.909 | 0.863 | 0.726 | 1e-113 | |
| 18420570 | 316 | haloacid dehalogenase-like hydrolase fam | 0.859 | 0.810 | 0.755 | 1e-112 | |
| 22022552 | 316 | AT4g39970/T5J17_140 [Arabidopsis thalian | 0.859 | 0.810 | 0.755 | 1e-112 | |
| 359496682 | 328 | PREDICTED: protein CbbY-like [Vitis vini | 0.788 | 0.716 | 0.827 | 1e-112 | |
| 356525461 | 323 | PREDICTED: protein CbbY, chromosomal-lik | 0.802 | 0.739 | 0.798 | 1e-112 | |
| 21593238 | 316 | unknown [Arabidopsis thaliana] | 0.859 | 0.810 | 0.748 | 1e-111 | |
| 449451423 | 309 | PREDICTED: protein CbbY-like [Cucumis sa | 0.845 | 0.815 | 0.735 | 1e-111 | |
| 356512689 | 310 | PREDICTED: protein CbbY, chromosomal-lik | 0.748 | 0.719 | 0.830 | 1e-110 | |
| 224093744 | 261 | predicted protein [Populus trichocarpa] | 0.741 | 0.846 | 0.834 | 1e-110 |
| >gi|255584279|ref|XP_002532876.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223527361|gb|EEF29505.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 427 bits (1098), Expect = e-117, Method: Compositional matrix adjust.
Identities = 208/289 (71%), Positives = 244/289 (84%), Gaps = 14/289 (4%)
Query: 3 STVILSQTATLSSSSSSTTTTAKFSSLTHNPIFHTNALR--FKSNKKPLSLSLTRKALRV 60
++++LSQ S+ S + FS L+ + H ++R F S + SL + V
Sbjct: 2 ASMLLSQ-----SNLSPNPLSRSFSFLSKSQTLHFRSIRRSFPSRRSHQSLCFS-----V 51
Query: 61 SASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQN 120
SASS SL+ALIFDCDGVI+ESEHLHRQAYNDAF+HFNVRC +S Q+L W P+FYDVLQN
Sbjct: 52 SASSASLEALIFDCDGVILESEHLHRQAYNDAFAHFNVRC--TSDQTLIWAPDFYDVLQN 109
Query: 121 QIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEP 180
+IGGGKPKMRWYFKEHGWPSSTIF+ PP D+ +A LID +QDWKTERY++IIKSGTV+P
Sbjct: 110 RIGGGKPKMRWYFKEHGWPSSTIFETPPEDDESRANLIDTLQDWKTERYKEIIKSGTVQP 169
Query: 181 RPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLAGDDVKQKKPD 240
RPGVL+LMDEAKAAGKK+AVCSAATKSSVILCLENLIGMERF+GLDCFLAGDDVK+KKPD
Sbjct: 170 RPGVLQLMDEAKAAGKKLAVCSAATKSSVILCLENLIGMERFQGLDCFLAGDDVKEKKPD 229
Query: 241 PSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQ 289
PSIYVTA+K+LG+SEKDCLVVEDSVIGLQAAT+AGM+CVITYTSSTA+Q
Sbjct: 230 PSIYVTASKKLGVSEKDCLVVEDSVIGLQAATKAGMSCVITYTSSTADQ 278
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297802106|ref|XP_002868937.1| hypothetical protein ARALYDRAFT_912489 [Arabidopsis lyrata subsp. lyrata] gi|297314773|gb|EFH45196.1| hypothetical protein ARALYDRAFT_912489 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18420570|ref|NP_568077.1| haloacid dehalogenase-like hydrolase family protein [Arabidopsis thaliana] gi|51969804|dbj|BAD43594.1| unnamed protein product [Arabidopsis thaliana] gi|51969872|dbj|BAD43628.1| unnamed protein product [Arabidopsis thaliana] gi|51970306|dbj|BAD43845.1| unnamed protein product [Arabidopsis thaliana] gi|332661747|gb|AEE87147.1| haloacid dehalogenase-like hydrolase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22022552|gb|AAM83233.1| AT4g39970/T5J17_140 [Arabidopsis thaliana] gi|23505871|gb|AAN28795.1| At4g39970/T5J17_140 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359496682|ref|XP_003635299.1| PREDICTED: protein CbbY-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356525461|ref|XP_003531343.1| PREDICTED: protein CbbY, chromosomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|21593238|gb|AAM65187.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449451423|ref|XP_004143461.1| PREDICTED: protein CbbY-like [Cucumis sativus] gi|449520016|ref|XP_004167030.1| PREDICTED: protein CbbY-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356512689|ref|XP_003525049.1| PREDICTED: protein CbbY, chromosomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224093744|ref|XP_002309972.1| predicted protein [Populus trichocarpa] gi|222852875|gb|EEE90422.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 298 | ||||||
| TAIR|locus:2140050 | 316 | AT4G39970 [Arabidopsis thalian | 0.845 | 0.797 | 0.763 | 8.6e-104 | |
| TAIR|locus:2101165 | 319 | AT3G48420 [Arabidopsis thalian | 0.788 | 0.736 | 0.387 | 7e-38 | |
| TIGR_CMR|GSU_1839 | 228 | GSU_1839 "hydrolase, haloacid | 0.385 | 0.504 | 0.367 | 5.1e-19 | |
| TIGR_CMR|BA_4427 | 221 | BA_4427 "hydrolase, haloacid d | 0.536 | 0.723 | 0.298 | 1.4e-18 | |
| UNIPROTKB|P77475 | 188 | yqaB [Escherichia coli K-12 (t | 0.362 | 0.574 | 0.318 | 6.6e-18 | |
| UNIPROTKB|Q9KN63 | 219 | VC_A0102 "CbbY family protein" | 0.379 | 0.515 | 0.333 | 1.3e-16 | |
| TIGR_CMR|VC_A0102 | 219 | VC_A0102 "haloacid dehalogenas | 0.379 | 0.515 | 0.333 | 1.3e-16 | |
| TAIR|locus:2010728 | 1055 | AT1G56500 [Arabidopsis thalian | 0.402 | 0.113 | 0.346 | 1.8e-13 | |
| TIGR_CMR|SO_0431 | 217 | SO_0431 "HAD-superfamily hydro | 0.419 | 0.576 | 0.316 | 2.9e-13 | |
| TIGR_CMR|DET_0395 | 456 | DET_0395 "glycoprotease family | 0.439 | 0.287 | 0.338 | 4e-13 |
| TAIR|locus:2140050 AT4G39970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1028 (366.9 bits), Expect = 8.6e-104, P = 8.6e-104
Identities = 197/258 (76%), Positives = 228/258 (88%)
Query: 33 PIFHTNALRFKSNKKPLSLSLTRKALRVSASS-QSLQALIFDCDGVIIESEHLHRQAYND 91
P F T LRFKS S +R + VSA +SL+ALIFDCDGVI+ESE+LHRQAYND
Sbjct: 33 PRFQT--LRFKSRSV---YSKSRVSSPVSALPLRSLEALIFDCDGVILESENLHRQAYND 87
Query: 92 AFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTD 151
AFSHF+VRC PSS +SL+W EFYD QN +GGGKPKMRWYFKE+GWP+STIFD+PP D
Sbjct: 88 AFSHFDVRCPPSSSESLDWSLEFYDKFQNLVGGGKPKMRWYFKENGWPTSTIFDSPPQND 147
Query: 152 DDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVIL 211
DD+AKLID +QDWKTERY++IIKSG+VEPRPGV+RLMDEAKAAGKK+AVCSAATKSSVIL
Sbjct: 148 DDRAKLIDTLQDWKTERYKEIIKSGSVEPRPGVIRLMDEAKAAGKKLAVCSAATKSSVIL 207
Query: 212 CLENLIGMERFEGLDCFLAGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAA 271
CLENLI +ERF+GLDCFLAGDDVK+KKPDPSIY+TAA++LG+S KDCLVVEDSVIGLQAA
Sbjct: 208 CLENLIDIERFQGLDCFLAGDDVKEKKPDPSIYITAAEKLGVSVKDCLVVEDSVIGLQAA 267
Query: 272 TRAGMACVITYTSSTAEQ 289
T+AGM+CVITYTSST++Q
Sbjct: 268 TKAGMSCVITYTSSTSDQ 285
|
|
| TAIR|locus:2101165 AT3G48420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1839 GSU_1839 "hydrolase, haloacid dehalogenase-like family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4427 BA_4427 "hydrolase, haloacid dehalogenase-like family" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P77475 yqaB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KN63 VC_A0102 "CbbY family protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_A0102 VC_A0102 "haloacid dehalogenase/epoxide hydrolase family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_0431 SO_0431 "HAD-superfamily hydrolase, subfamily IA, variant 3 protein family" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0395 DET_0395 "glycoprotease family protein/hydrolase, beta-phosphoglucomutase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| scaffold_700231.1 | annotation not avaliable (314 aa) | ||||||||||
(Arabidopsis lyrata) | |||||||||||
| Al_scaffold_0003_1112 | • | • | • | 0.645 | |||||||
| fgenesh2_kg.6__3113__AT4G11570.1 | • | • | 0.641 | ||||||||
| fgenesh2_kg.8__1659__AT5G57440.1 | • | • | 0.627 | ||||||||
| fgenesh1_pg.C_scaffold_3002379 | • | • | 0.494 | ||||||||
| fgenesh1_pm.C_scaffold_4001112 | • | • | 0.474 | ||||||||
| scaffold_105623.1 | • | • | • | 0.460 | |||||||
| fgenesh2_kg.2__2421__AT1G79790.1 | • | • | 0.452 | ||||||||
| scaffold_604018.1 | • | 0.450 | |||||||||
| fgenesh2_kg.1__3345__AT1G32080.1 | • | 0.450 | |||||||||
| fgenesh2_kg.1__1751__AT1G15980.1 | • | 0.438 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 298 | |||
| PLN02779 | 286 | PLN02779, PLN02779, haloacid dehalogenase-like hyd | 1e-136 | |
| COG0637 | 221 | COG0637, COG0637, Predicted phosphatase/phosphohex | 1e-39 | |
| TIGR02009 | 185 | TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase f | 2e-29 | |
| COG0546 | 220 | COG0546, Gph, Predicted phosphatases [General func | 8e-23 | |
| TIGR01990 | 185 | TIGR01990, bPGM, beta-phosphoglucomutase | 1e-22 | |
| TIGR01509 | 177 | TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup | 3e-21 | |
| pfam13419 | 176 | pfam13419, HAD_2, Haloacid dehalogenase-like hydro | 7e-20 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 9e-20 | |
| PRK10725 | 188 | PRK10725, PRK10725, fructose-1-P/6-phosphogluconat | 4e-18 | |
| PLN02919 | 1057 | PLN02919, PLN02919, haloacid dehalogenase-like hyd | 2e-15 | |
| PRK10826 | 222 | PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; | 2e-14 | |
| TIGR01449 | 213 | TIGR01449, PGP_bact, 2-phosphoglycolate phosphatas | 2e-14 | |
| PLN02940 | 382 | PLN02940, PLN02940, riboflavin kinase | 8e-13 | |
| COG1011 | 229 | COG1011, COG1011, Predicted hydrolase (HAD superfa | 5e-12 | |
| PRK10563 | 221 | PRK10563, PRK10563, 6-phosphogluconate phosphatase | 9e-12 | |
| PRK13222 | 226 | PRK13222, PRK13222, phosphoglycolate phosphatase; | 1e-11 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 2e-11 | |
| PLN03243 | 260 | PLN03243, PLN03243, haloacid dehalogenase-like hyd | 3e-09 | |
| PLN02811 | 220 | PLN02811, PLN02811, hydrolase | 1e-08 | |
| pfam13242 | 74 | pfam13242, Hydrolase_like, HAD-hyrolase-like | 2e-08 | |
| TIGR01549 | 162 | TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase sup | 4e-08 | |
| PLN02770 | 248 | PLN02770, PLN02770, haloacid dehalogenase-like hyd | 2e-07 | |
| TIGR01454 | 205 | TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic | 2e-07 | |
| TIGR02253 | 221 | TIGR02253, CTE7, HAD superfamily (subfamily IA) hy | 6e-07 | |
| PRK11587 | 218 | PRK11587, PRK11587, putative phosphatase; Provisio | 1e-06 | |
| PRK13288 | 214 | PRK13288, PRK13288, pyrophosphatase PpaX; Provisio | 2e-06 | |
| TIGR03351 | 220 | TIGR03351, PhnX-like, phosphonatase-like hydrolase | 5e-06 | |
| PRK13226 | 229 | PRK13226, PRK13226, phosphoglycolate phosphatase; | 1e-05 | |
| PLN02575 | 381 | PLN02575, PLN02575, haloacid dehalogenase-like hyd | 3e-05 | |
| TIGR01422 | 253 | TIGR01422, phosphonatase, phosphonoacetaldehyde hy | 3e-05 | |
| PRK13223 | 272 | PRK13223, PRK13223, phosphoglycolate phosphatase; | 4e-05 | |
| TIGR01548 | 197 | TIGR01548, HAD-SF-IA-hyp1, haloacid dehalogenase s | 3e-04 | |
| PRK13478 | 267 | PRK13478, PRK13478, phosphonoacetaldehyde hydrolas | 6e-04 | |
| COG2179 | 175 | COG2179, COG2179, Predicted hydrolase of the HAD s | 0.001 | |
| TIGR01428 | 198 | TIGR01428, HAD_type_II, 2-haloalkanoic acid dehalo | 0.001 | |
| TIGR01662 | 132 | TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, | 0.001 | |
| COG0647 | 269 | COG0647, NagD, Predicted sugar phosphatases of the | 0.003 | |
| TIGR01993 | 183 | TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleoti | 0.004 |
| >gnl|CDD|215416 PLN02779, PLN02779, haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
Score = 387 bits (996), Expect = e-136
Identities = 122/260 (46%), Positives = 167/260 (64%), Gaps = 15/260 (5%)
Query: 35 FHTNALRFKSNKKPLSLSLTRKALRV----SASSQSLQALIFDCDGVIIESE-HLHRQAY 89
+ L S + R +++S +AL+FDCDGV++E+E HR A+
Sbjct: 4 SSSARLASASRTRAGRRRRRRSRSTARVASASASALPEALLFDCDGVLVETERDGHRVAF 63
Query: 90 NDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPV 149
NDAF F +R + WD E YD L N IGGGK +M WYF E+GWP+STI + P
Sbjct: 64 NDAFKEFGLR-------PVEWDVELYDELLN-IGGGKERMTWYFNENGWPTSTI-EKAPK 114
Query: 150 TDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSV 209
++++ +L+D + D KTE ++++I+SG + RPGVLRLMDEA AAG KVAVCS + + +V
Sbjct: 115 DEEERKELVDSLHDRKTELFKELIESGALPLRPGVLRLMDEALAAGIKVAVCSTSNEKAV 174
Query: 210 ILCLENLIGMERFEGLDCFLAGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQ 269
+ L+G ER +GLD F AGDDV +KKPDP IY AA+ LG+ C+VVEDSVIGLQ
Sbjct: 175 SKIVNTLLGPERAQGLDVF-AGDDVPKKKPDPDIYNLAAETLGVDPSRCVVVEDSVIGLQ 233
Query: 270 AATRAGMACVITYTSSTAEQ 289
AA AGM C++T +S TA++
Sbjct: 234 AAKAAGMRCIVTKSSYTADE 253
|
Length = 286 |
| >gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213673 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213672 TIGR01990, bPGM, beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|236770 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130516 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182552 PRK10563, PRK10563, 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|215644 PLN03243, PLN03243, haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178407 PLN02811, PLN02811, hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like | Back alignment and domain information |
|---|
| >gnl|CDD|233463 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >gnl|CDD|215413 PLN02770, PLN02770, haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|130521 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >gnl|CDD|183215 PRK11587, PRK11587, putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237336 PRK13288, PRK13288, pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234176 TIGR03351, PhnX-like, phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|237311 PRK13226, PRK13226, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215313 PLN02575, PLN02575, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|188140 TIGR01422, phosphonatase, phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|171912 PRK13223, PRK13223, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233462 TIGR01548, HAD-SF-IA-hyp1, haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >gnl|CDD|184075 PRK13478, PRK13478, phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225090 COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130495 TIGR01428, HAD_type_II, 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233675 TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 298 | |||
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 100.0 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 100.0 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.98 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.97 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.97 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.97 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.97 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.97 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.97 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.97 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.97 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.97 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.97 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.97 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.97 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.97 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.96 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.96 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.96 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.96 | |
| PLN02940 | 382 | riboflavin kinase | 99.96 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.96 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.96 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.96 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.96 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.96 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.96 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.96 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.95 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.95 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.95 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.95 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.94 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.94 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.94 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.94 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.93 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.93 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.93 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 99.93 | |
| PLN02811 | 220 | hydrolase | 99.93 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.93 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 99.92 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.9 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.89 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.89 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.88 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.88 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.87 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.87 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.86 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.85 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.84 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.84 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.83 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.83 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.83 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.82 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 99.82 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.82 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 99.79 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 99.77 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.76 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.76 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.75 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 99.74 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.74 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 99.73 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 99.72 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 99.72 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 99.71 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.7 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.7 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.7 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.69 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.69 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.69 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 99.66 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.66 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 99.65 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.64 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.6 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 99.59 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 99.58 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 99.58 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.58 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.55 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.55 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 99.55 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 99.54 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 99.54 | |
| PRK08238 | 479 | hypothetical protein; Validated | 99.52 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 99.51 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 99.49 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.49 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.49 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.48 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 99.45 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 99.43 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 99.38 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.37 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.36 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.35 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 99.35 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 99.32 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.3 | |
| PLN02887 | 580 | hydrolase family protein | 99.3 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 99.29 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 99.28 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.28 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 99.27 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.27 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 99.24 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.24 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 99.23 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 99.22 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 99.21 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.19 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 99.19 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 99.19 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 99.19 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 99.18 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.18 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.16 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 99.14 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.12 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 99.0 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 99.0 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 98.99 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 98.99 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.97 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 98.9 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 98.9 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 98.87 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 98.82 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 98.82 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 98.81 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 98.76 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 98.75 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 98.75 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 98.72 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.71 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 98.69 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 98.68 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 98.66 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 98.61 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 98.59 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 98.59 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 98.58 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 98.57 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 98.49 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 98.44 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 98.41 | |
| PLN02423 | 245 | phosphomannomutase | 98.4 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 98.38 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.38 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 98.36 | |
| KOG2630 | 254 | consensus Enolase-phosphatase E-1 [Amino acid tran | 98.33 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 98.32 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 98.29 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 98.27 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 98.21 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 98.2 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 98.19 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 98.16 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.15 | |
| PF05761 | 448 | 5_nucleotid: 5' nucleotidase family; InterPro: IPR | 98.08 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 98.07 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 98.03 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 98.01 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 98.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 97.96 | |
| TIGR01658 | 274 | EYA-cons_domain eyes absent protein conserved doma | 97.96 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 97.96 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 97.95 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 97.95 | |
| COG5663 | 194 | Uncharacterized conserved protein [Function unknow | 97.93 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 97.86 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 97.83 | |
| KOG3107 | 468 | consensus Predicted haloacid dehalogenase-like hyd | 97.79 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 97.76 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 97.67 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 97.6 | |
| COG5610 | 635 | Predicted hydrolase (HAD superfamily) [General fun | 97.57 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 97.54 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 97.45 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.44 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 97.39 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 97.37 | |
| PLN02580 | 384 | trehalose-phosphatase | 97.29 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 97.25 | |
| KOG2470 | 510 | consensus Similar to IMP-GMP specific 5'-nucleotid | 97.23 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 97.21 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 97.18 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 97.18 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 97.13 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 97.04 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 96.94 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 96.82 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 96.73 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 96.62 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 96.59 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 96.56 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 96.45 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 96.38 | |
| KOG3128 | 298 | consensus Uncharacterized conserved protein [Funct | 96.34 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 96.33 | |
| PF05822 | 246 | UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter | 96.28 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 96.17 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 96.07 | |
| COG4502 | 180 | 5'(3')-deoxyribonucleotidase [Nucleotide transport | 95.83 | |
| PLN02151 | 354 | trehalose-phosphatase | 95.75 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 95.49 | |
| KOG1618 | 389 | consensus Predicted phosphatase [General function | 95.39 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 95.27 | |
| PF06189 | 264 | 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 | 94.98 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 94.96 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 94.63 | |
| PLN03017 | 366 | trehalose-phosphatase | 94.44 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 94.35 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 94.22 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 94.1 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 92.45 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 92.16 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 91.5 | |
| KOG2469 | 424 | consensus IMP-GMP specific 5'-nucleotidase [Nucleo | 91.39 | |
| KOG4549 | 144 | consensus Magnesium-dependent phosphatase [General | 91.02 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 90.96 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 90.55 | |
| PRK00994 | 277 | F420-dependent methylenetetrahydromethanopterin de | 90.18 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 90.01 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 89.85 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 89.36 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 88.38 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 88.14 | |
| cd00733 | 279 | GlyRS_alpha_core Class II Glycyl-tRNA synthetase ( | 88.1 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 88.05 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 87.75 | |
| TIGR00388 | 293 | glyQ glycyl-tRNA synthetase, tetrameric type, alph | 87.53 | |
| PRK09348 | 283 | glyQ glycyl-tRNA synthetase subunit alpha; Validat | 87.46 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 86.84 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 86.7 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 86.52 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 86.4 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 86.32 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 85.28 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 85.12 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 85.0 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 84.61 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 84.56 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 84.32 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 84.21 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 83.92 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 83.68 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 83.49 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 83.31 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 82.89 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 82.73 | |
| COG0731 | 296 | Fe-S oxidoreductases [Energy production and conver | 82.66 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 82.37 | |
| COG0752 | 298 | GlyQ Glycyl-tRNA synthetase, alpha subunit [Transl | 80.58 | |
| PRK13762 | 322 | tRNA-modifying enzyme; Provisional | 80.4 |
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-32 Score=232.50 Aligned_cols=218 Identities=54% Similarity=0.940 Sum_probs=160.4
Q ss_pred CcCCccEEEEecCCccccch-hHHHHHHHHHHhhcCCCCCCCccccCCCChHHHHHHHHHhcCChhhHHHHHHHcCCCCC
Q 022348 63 SSQSLQALIFDCDGVIIESE-HLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSS 141 (298)
Q Consensus 63 ~~~~~k~viFD~DGTL~d~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~ 141 (298)
....+++|||||||||+|+. ..+..+|.++++++|++... +....+..+.. +|++...+..++...+++..
T Consensus 36 ~~~~~k~VIFDlDGTLvDS~~~~~~~a~~~~l~~~G~~~~~-------~~~~~~~~~~~-~g~~~~~~~~~~~~~~~~~~ 107 (286)
T PLN02779 36 ASALPEALLFDCDGVLVETERDGHRVAFNDAFKEFGLRPVE-------WDVELYDELLN-IGGGKERMTWYFNENGWPTS 107 (286)
T ss_pred cccCCcEEEEeCceeEEccccHHHHHHHHHHHHHcCCCCCC-------CCHHHHHHHHc-cCCChHHHHHHHHHcCCCcc
Confidence 34468999999999999999 99999999999999884211 12233333333 77777667666665555432
Q ss_pred cccCCCCCCChhHHHHHHHHHHHHHHHHHHHHhcCCCCCChhHHHHHHHHHHCCCeEEEEeCCChhhHHHHHHHHhCCcc
Q 022348 142 TIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMER 221 (298)
Q Consensus 142 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~~~l~~L~~~g~~i~i~S~~~~~~~~~~l~~~~~l~~ 221 (298)
.+ ...+..++...+..+.+.+.+.+.|...+....+.++||+.++|+.|+++|++++|+||+....+...++.+.+...
T Consensus 108 ~~-~~~~~~~e~~~~~~~~~~~~~~~~y~~~~~~~~~~l~pGv~elL~~L~~~g~~l~IvTn~~~~~~~~~l~~~~~~~~ 186 (286)
T PLN02779 108 TI-EKAPKDEEERKELVDSLHDRKTELFKELIESGALPLRPGVLRLMDEALAAGIKVAVCSTSNEKAVSKIVNTLLGPER 186 (286)
T ss_pred cc-ccCCccchhhHHHHHHHHHHHHHHHHHHHHhcCCCchhhHHHHHHHHHHCCCeEEEEeCCCHHHHHHHHHHhccccc
Confidence 22 11112233334445555555666677665444568999999999999999999999999999988888887622232
Q ss_pred ccCcceEEeCCCCCCCCCCHHHHHHHHHHhCCCCCcEEEEecChhhHHHHHHcCCeEEEE-cCCCchhHh
Q 022348 222 FEGLDCFLAGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVIT-YTSSTAEQV 290 (298)
Q Consensus 222 ~~~fd~v~~~~~~~~~KP~~~~~~~~~~~lgi~~~~~~~vgD~~~Di~~a~~aG~~~v~~-~~~~~~~~~ 290 (298)
+..|+.+ ++++++..||+|++|..+++++|++|++|+||||+.+|+++|+++|+.+|++ ++....+++
T Consensus 187 ~~~~~~v-~~~~~~~~KP~p~~~~~a~~~~~~~p~~~l~IGDs~~Di~aA~~aG~~~i~v~~g~~~~~~l 255 (286)
T PLN02779 187 AQGLDVF-AGDDVPKKKPDPDIYNLAAETLGVDPSRCVVVEDSVIGLQAAKAAGMRCIVTKSSYTADEDF 255 (286)
T ss_pred cCceEEE-eccccCCCCCCHHHHHHHHHHhCcChHHEEEEeCCHHhHHHHHHcCCEEEEEccCCcccccc
Confidence 3224555 7888888999999999999999999999999999999999999999999966 444444444
|
|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01658 EYA-cons_domain eyes absent protein conserved domain | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >COG5663 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3107 consensus Predicted haloacid dehalogenase-like hydrolase (eyes absent) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >KOG3128 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice | Back alignment and domain information |
|---|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >KOG1618 consensus Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2469 consensus IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd00733 GlyRS_alpha_core Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >TIGR00388 glyQ glycyl-tRNA synthetase, tetrameric type, alpha subunit | Back alignment and domain information |
|---|
| >PRK09348 glyQ glycyl-tRNA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >COG0731 Fe-S oxidoreductases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >COG0752 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13762 tRNA-modifying enzyme; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 298 | ||||
| 3e58_A | 214 | Crystal Structure Of Putative Beta-Phosphoglucomuta | 4e-13 | ||
| 4g9b_A | 243 | Crystal Structure Of Beta-Phosphoglucomutase Homolo | 2e-10 | ||
| 3kbb_A | 216 | Crystal Structure Of Putative Beta-Phosphoglucomuta | 7e-10 | ||
| 3nas_A | 233 | The Crystal Structure Of Beta-Phosphoglucomutase Fr | 2e-09 | ||
| 3dv9_A | 247 | Putative Beta-Phosphoglucomutase From Bacteroides V | 2e-09 | ||
| 3quq_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 3e-08 | ||
| 3r9k_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 4e-08 | ||
| 3qyp_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 6e-08 | ||
| 4gib_A | 250 | 2.27 Angstrom Crystal Structure Of Beta-Phosphogluc | 8e-08 | ||
| 3qub_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 9e-08 | ||
| 3qu5_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 1e-07 | ||
| 3qut_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 1e-07 | ||
| 3qu4_A | 243 | Crystal Structure Of Pyrophosphatase From Bacteroid | 3e-07 | ||
| 3l5k_A | 250 | The Crystal Structure Of Human Haloacid Dehalogenas | 6e-07 | ||
| 3fm9_A | 221 | Analysis Of The Structural Determinants Underlying | 1e-06 | ||
| 1o03_A | 221 | Structure Of Pentavalent Phosphorous Intermediate O | 1e-06 | ||
| 1lvh_A | 221 | The Structure Of Phosphorylated Beta-phosphoglucomu | 2e-06 | ||
| 2hi0_A | 240 | Crystal Structure Of Putative Phosphoglycolate Phos | 1e-05 | ||
| 4ex6_A | 237 | Crystal Structure Of The Alnumycin P Phosphatase Al | 1e-05 | ||
| 2nyv_A | 222 | X-Ray Crystal Structure Of A Phosphoglycolate Phosp | 1e-05 | ||
| 4eek_A | 259 | Crystal Structure Of Had Family Hydrolase Dr_1622 F | 3e-05 | ||
| 2yy6_A | 213 | Crystal Structure Of The Phosphoglycolate Phosphata | 9e-05 | ||
| 2no4_A | 240 | Crystal Structure Analysis Of A Dehalogenase Length | 3e-04 | ||
| 2no5_A | 240 | Crystal Structure Analysis Of A Dehalogenase With I | 3e-04 | ||
| 3s6j_A | 233 | The Crystal Structure Of A Hydrolase From Pseudomon | 4e-04 | ||
| 3d6j_A | 225 | Crystal Structure Of Putative Haloacid Dehalogenase | 5e-04 | ||
| 1te2_A | 226 | Putative Phosphatase Ynic From Escherichia Coli K12 | 5e-04 |
| >pdb|3E58|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Streptococcus Thermophilus Length = 214 | Back alignment and structure |
|
| >pdb|4G9B|A Chain A, Crystal Structure Of Beta-Phosphoglucomutase Homolog From Escherichia Coli, Target Efi-501172, With Bound Mg, Open Lid Length = 243 | Back alignment and structure |
| >pdb|3KBB|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Thermotoga Maritima Length = 216 | Back alignment and structure |
| >pdb|3NAS|A Chain A, The Crystal Structure Of Beta-Phosphoglucomutase From Bacillus Subtilis Length = 233 | Back alignment and structure |
| >pdb|3DV9|A Chain A, Putative Beta-Phosphoglucomutase From Bacteroides Vulgatus Length = 247 | Back alignment and structure |
| >pdb|3QUQ|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, An Open Cap Conformation Length = 243 | Back alignment and structure |
| >pdb|3R9K|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asp Mutant Complexed With Sulfate, A Closed Cap Conformation Length = 243 | Back alignment and structure |
| >pdb|3QYP|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asn Mutant Complexed With Calcium And Phosphate Length = 243 | Back alignment and structure |
| >pdb|4GIB|A Chain A, 2.27 Angstrom Crystal Structure Of Beta-Phosphoglucomutase (Pgmb) From Clostridium Difficile Length = 250 | Back alignment and structure |
| >pdb|3QUB|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47ala Mutant Complexed With Sulfate Length = 243 | Back alignment and structure |
| >pdb|3QU5|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp11asn Mutant Length = 243 | Back alignment and structure |
| >pdb|3QUT|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13asn Mutant, An Open Cap Conformation Length = 243 | Back alignment and structure |
| >pdb|3QU4|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13ala Mutant Length = 243 | Back alignment and structure |
| >pdb|3L5K|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 1a (Hdhd1a) Length = 250 | Back alignment and structure |
| >pdb|3FM9|A Chain A, Analysis Of The Structural Determinants Underlying Discrimination Between Substrate And Solvent In Beta- Phosphoglucomutase Catalysis Length = 221 | Back alignment and structure |
| >pdb|1O03|A Chain A, Structure Of Pentavalent Phosphorous Intermediate Of An Enzyme Catalyzed Phosphoryl Transfer Reaction Observed On Cocrystallization With Glucose 6-Phosphate Length = 221 | Back alignment and structure |
| >pdb|1LVH|A Chain A, The Structure Of Phosphorylated Beta-phosphoglucomutase From Lactoccocus Lactis To 2.3 Angstrom Resolution Length = 221 | Back alignment and structure |
| >pdb|2HI0|A Chain A, Crystal Structure Of Putative Phosphoglycolate Phosphatase (Yp_619066.1) From Lactobacillus Delbrueckii Subsp. Bulgaricus Atcc Baa-365 At 1.51 A Resolution Length = 240 | Back alignment and structure |
| >pdb|4EX6|A Chain A, Crystal Structure Of The Alnumycin P Phosphatase Alnb Length = 237 | Back alignment and structure |
| >pdb|2NYV|A Chain A, X-Ray Crystal Structure Of A Phosphoglycolate Phosphatase From Aquifex Aeolicus Length = 222 | Back alignment and structure |
| >pdb|4EEK|A Chain A, Crystal Structure Of Had Family Hydrolase Dr_1622 From Deinococcus Radiodurans R1 (Target Efi-501256) With Bound Phosphate And Sodium Length = 259 | Back alignment and structure |
| >pdb|2YY6|A Chain A, Crystal Structure Of The Phosphoglycolate Phosphatase From Aquifex Aeolicus Vf5 Length = 213 | Back alignment and structure |
| >pdb|2NO4|A Chain A, Crystal Structure Analysis Of A Dehalogenase Length = 240 | Back alignment and structure |
| >pdb|2NO5|A Chain A, Crystal Structure Analysis Of A Dehalogenase With Intermediate Complex Length = 240 | Back alignment and structure |
| >pdb|3S6J|A Chain A, The Crystal Structure Of A Hydrolase From Pseudomonas Syringae Length = 233 | Back alignment and structure |
| >pdb|3D6J|A Chain A, Crystal Structure Of Putative Haloacid Dehalogenase-Like Hydrolase From Bacteroides Fragilis Length = 225 | Back alignment and structure |
| >pdb|1TE2|A Chain A, Putative Phosphatase Ynic From Escherichia Coli K12 Length = 226 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 298 | |||
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 4e-52 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 2e-50 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 8e-50 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 9e-50 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 3e-49 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 4e-49 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 5e-49 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 1e-48 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 1e-48 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 9e-47 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 3e-42 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 4e-42 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 4e-39 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 4e-34 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 6e-28 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 3e-24 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 7e-23 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 2e-22 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 3e-21 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 3e-21 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 4e-21 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 3e-20 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 2e-19 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 3e-19 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 2e-18 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 1e-17 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 2e-17 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 2e-17 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 4e-17 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 2e-16 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 1e-15 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 1e-15 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 3e-15 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 3e-15 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 1e-14 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 2e-14 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 1e-13 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 3e-13 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 4e-13 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 1e-12 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 9e-12 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 1e-10 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 4e-10 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 5e-10 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 2e-09 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 2e-08 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 2e-08 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 6e-08 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 1e-07 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 1e-07 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 2e-06 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 2e-06 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 3e-06 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 5e-06 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 3e-05 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 8e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 | Back alignment and structure |
|---|
Score = 169 bits (431), Expect = 4e-52
Identities = 45/230 (19%), Positives = 86/230 (37%), Gaps = 30/230 (13%)
Query: 62 ASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQ 121
++ + + A IFD DG++I+SE L +A D + V + + L +
Sbjct: 4 STPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGV----------DISRR--NELPDT 51
Query: 122 IGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPR 181
+G + + P + ++++ R +++
Sbjct: 52 LGLRIDMVVDLWYAR----------QPWNGPSRQEVVE----RVIARAISLVEET-RPLL 96
Query: 182 PGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLAGDDVKQKKPDP 241
PGV + K G V + SA+ + L + F D + + + KP P
Sbjct: 97 PGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSF---DALASAEKLPYSKPHP 153
Query: 242 SIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQVR 291
+Y+ A +LG+ C+ +EDSV G+ A+ A M ++ R
Sbjct: 154 QVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPR 203
|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Length = 234 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Length = 196 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Length = 243 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Length = 282 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Length = 232 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Length = 253 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Length = 240 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Length = 231 | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Length = 253 | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Length = 187 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Length = 201 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 298 | |||
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 100.0 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.98 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.97 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.97 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.97 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.97 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.96 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.96 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.96 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.96 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.96 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.96 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.96 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.96 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.96 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.96 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.96 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.96 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.95 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.95 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.95 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.95 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.95 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.95 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.95 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.95 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.95 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.95 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.95 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.95 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.95 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.95 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.95 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.94 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.94 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.94 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.94 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.94 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.94 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.94 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.94 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.94 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.94 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.94 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.94 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.94 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.93 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.93 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.93 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.93 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.93 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.93 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.93 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.93 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.93 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.92 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.92 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.92 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.91 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.91 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.91 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.91 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.9 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.89 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.89 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.89 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.88 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.88 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.87 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.87 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.87 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.85 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.85 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.85 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.85 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 99.85 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.85 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.85 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.84 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.84 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.83 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.82 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.82 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.82 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 99.81 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.8 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.79 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.79 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.78 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.78 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.78 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.78 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.78 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.78 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.77 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.77 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.77 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.77 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.77 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 99.76 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.76 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.75 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.74 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.72 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.71 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.71 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.71 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.7 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 99.68 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.68 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.68 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.67 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.67 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 99.48 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.66 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.65 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.63 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 99.62 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.6 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 99.6 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.59 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.57 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.57 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.56 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.51 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.44 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.42 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.4 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 99.35 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 99.33 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.32 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.3 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 99.29 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 99.28 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.22 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 99.2 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 99.17 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.08 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 99.08 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.07 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 99.04 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.02 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.0 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 98.71 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 98.49 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 98.42 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 98.36 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 98.35 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.34 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 98.17 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 98.11 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 97.99 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 97.99 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 97.9 | |
| 3geb_A | 274 | EYES absent homolog 2; hydrolase, activator, alter | 97.87 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 97.76 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 97.74 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 97.65 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 97.61 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 97.24 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.66 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 96.48 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.24 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 95.89 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 95.88 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 95.88 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 95.58 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 95.58 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 94.85 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 94.22 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 91.86 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 90.63 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 89.89 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 89.76 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 88.63 | |
| 2pju_A | 225 | Propionate catabolism operon regulatory protein; s | 86.6 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 85.94 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 85.44 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 83.27 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 82.66 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 81.95 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 81.37 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 80.34 |
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-32 Score=223.30 Aligned_cols=195 Identities=24% Similarity=0.409 Sum_probs=153.5
Q ss_pred ccEEEEecCCccccchhHHHHHHHHHHhhcCCCCCCCccccCCCChHHHHHHHHHhcCChhhHHHHH-HHcCCCCCcccC
Q 022348 67 LQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYF-KEHGWPSSTIFD 145 (298)
Q Consensus 67 ~k~viFD~DGTL~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~-~~~g~~~~~~~~ 145 (298)
+|+|+||+||||+|+...+.++|.++++++|++... +......|.......... ...+..
T Consensus 1 IkAViFD~DGTL~ds~~~~~~a~~~~~~~~g~~~~~-------------~~~~~~~g~~~~~~~~~~~~~~~~~------ 61 (216)
T 3kbb_A 1 MEAVIFDMDGVLMDTEPLYFEAYRRVAESYGKPYTE-------------DLHRRIMGVPEREGLPILMEALEIK------ 61 (216)
T ss_dssp CCEEEEESBTTTBCCGGGHHHHHHHHHHHTTCCCCH-------------HHHHHHTTSCHHHHHHHHHHHTTCC------
T ss_pred CeEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCH-------------HHHHHHhccchhhhhhhhhhcccch------
Confidence 689999999999999999999999999999876422 233445565555443333 332221
Q ss_pred CCCCCChhHHHHHHHHHHHHHHHHHHHHhcCCCCCChhHHHHHHHHHHCCCeEEEEeCCChhhHHHHHHHHhCCccccCc
Q 022348 146 NPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGL 225 (298)
Q Consensus 146 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~~~l~~L~~~g~~i~i~S~~~~~~~~~~l~~~~~l~~~~~f 225 (298)
.....+...+.+.+...+... ..++||+.++++.|+++|++++++||+....+...++.+ ++..+ |
T Consensus 62 ------~~~~~~~~~~~~~~~~~~~~~-----~~~~pg~~~~l~~L~~~g~~~~i~tn~~~~~~~~~l~~~-~l~~~--f 127 (216)
T 3kbb_A 62 ------DSLENFKKRVHEEKKRVFSEL-----LKENPGVREALEFVKSKRIKLALATSTPQREALERLRRL-DLEKY--F 127 (216)
T ss_dssp ------SCHHHHHHHHHHHHHHHHHHH-----CCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHT-TCGGG--C
T ss_pred ------hhHHHHHHHHHHHHHHHHHHh-----cccCccHHHHHHHHHHcCCCcccccCCcHHHHHHHHHhc-CCCcc--c
Confidence 122333334444444434433 478999999999999999999999999999999999998 99998 9
Q ss_pred ceEEeCCCCCCCCCCHHHHHHHHHHhCCCCCcEEEEecChhhHHHHHHcCCeEEE--EcCCCchhHhhhcC
Q 022348 226 DCFLAGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVI--TYTSSTAEQVRIID 294 (298)
Q Consensus 226 d~v~~~~~~~~~KP~~~~~~~~~~~lgi~~~~~~~vgD~~~Di~~a~~aG~~~v~--~~~~~~~~~~~~~~ 294 (298)
|.++++++++..||+|++|..+++++|++|++|+||||+.+|+++|+++||++|+ .++....+++.+.+
T Consensus 128 d~~~~~~~~~~~KP~p~~~~~a~~~lg~~p~e~l~VgDs~~Di~aA~~aG~~~i~~v~~g~~~~~~l~~~~ 198 (216)
T 3kbb_A 128 DVMVFGDQVKNGKPDPEIYLLVLERLNVVPEKVVVFEDSKSGVEAAKSAGIERIYGVVHSLNDGKALLEAG 198 (216)
T ss_dssp SEEECGGGSSSCTTSTHHHHHHHHHHTCCGGGEEEEECSHHHHHHHHHTTCCCEEEECCSSSCCHHHHHTT
T ss_pred cccccccccCCCcccHHHHHHHHHhhCCCccceEEEecCHHHHHHHHHcCCcEEEEecCCCCCHHHHHhCC
Confidence 9999999999999999999999999999999999999999999999999999984 44555666666554
|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 298 | ||||
| d1cr6a1 | 222 | c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal | 7e-24 | |
| d1zs9a1 | 253 | c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien | 2e-19 | |
| d1zd3a1 | 225 | c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal | 2e-18 | |
| d1swva_ | 257 | c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba | 3e-17 | |
| d1o08a_ | 221 | c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu | 6e-17 | |
| d2b0ca1 | 197 | c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc | 2e-15 | |
| d1te2a_ | 218 | c.108.1.6 (A:) Phosphatase YniC {Escherichia coli | 4e-15 | |
| d2fi1a1 | 187 | c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str | 7e-14 | |
| d2hcfa1 | 228 | c.108.1.6 (A:2-229) Hypothetical protein CT1708 {C | 2e-13 | |
| d2g80a1 | 225 | c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast | 3e-12 | |
| d2fdra1 | 222 | c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { | 4e-12 | |
| d1qq5a_ | 245 | c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan | 5e-12 | |
| d2go7a1 | 204 | c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S | 2e-11 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 5e-11 | |
| d1zrna_ | 220 | c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pse | 6e-11 | |
| d2gfha1 | 247 | c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas | 1e-10 | |
| d2hsza1 | 224 | c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G | 2e-10 | |
| d2hdoa1 | 207 | c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { | 9e-10 | |
| d1u7pa_ | 164 | c.108.1.17 (A:) Magnesium-dependent phosphatase-1, | 6e-09 | |
| d2ah5a1 | 210 | c.108.1.6 (A:1-210) predicted phosphatase SP0104 { | 1e-07 | |
| d2feaa1 | 226 | c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio | 4e-07 | |
| d1x42a1 | 230 | c.108.1.1 (A:1-230) Hypothetical protein PH0459 {A | 6e-07 | |
| d1nnla_ | 217 | c.108.1.4 (A:) Phosphoserine phosphatase {Human (H | 0.001 |
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: YihX-like domain: Epoxide hydrolase, N-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 94.8 bits (234), Expect = 7e-24
Identities = 29/225 (12%), Positives = 61/225 (27%), Gaps = 17/225 (7%)
Query: 69 ALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPK 128
FD DGV+ A+ + + +F P
Sbjct: 2 VAAFDLDGVLALPSIAG--AFRRSEEALAL------------PRDFLLGAYQTEFPEGPT 47
Query: 129 MRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLM 188
+ + + + +A +L +++ + + +L+
Sbjct: 48 EQLMKGKITFSQWVPLMDESYRKSSKACGANLPENFSISQIFSQAMAAR-SINRPMLQAA 106
Query: 189 DEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGL-DCFLAGDDVKQKKPDPSIYVTA 247
K G + + M D + V KP+P IY
Sbjct: 107 IALKKKGFTTCIVTNNWLDDGDKRDSLAQMMCELSQHFDFLIESCQVGMIKPEPQIYNFL 166
Query: 248 AKRLGISEKDCLVVEDSVIGLQAATRAGMACV-ITYTSSTAEQVR 291
L + + ++D L+ A GM + + T+S ++
Sbjct: 167 LDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALRELE 211
|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Length = 228 | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Length = 220 | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Length = 210 | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 298 | |||
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 100.0 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.97 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.97 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.97 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.97 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.97 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.96 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.96 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.96 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.95 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.95 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.95 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.93 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.93 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.92 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.92 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.91 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.9 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.85 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.84 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.82 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.8 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.8 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.79 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 99.75 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.75 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.74 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 99.73 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 99.71 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 99.68 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.65 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.62 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.43 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.34 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 99.29 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.29 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 99.26 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.17 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 99.15 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.12 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 99.1 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 99.09 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.06 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 99.05 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.03 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 98.88 | |
| d2bdea1 | 458 | Cytosolic IMP-GMP specific 5'-nucleotidase {Legion | 98.74 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.7 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 98.7 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 98.62 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 98.35 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 98.31 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.07 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 97.99 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 97.66 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.45 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 96.52 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 96.11 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 92.57 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 91.01 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 89.82 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 87.87 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 87.46 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 87.41 | |
| d2pjua1 | 186 | Propionate catabolism operon regulatory protein Pr | 86.19 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 84.65 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 84.05 |
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: beta-Phosphoglucomutase-like domain: Phosphatase YniC species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.6e-32 Score=221.39 Aligned_cols=195 Identities=23% Similarity=0.369 Sum_probs=148.0
Q ss_pred CccEEEEecCCccccchhHHHHHHHHHHhhcCCCCCCCccccCCCChHHHHHHHHHhcCChhhHHHHH-HHcCCCCCccc
Q 022348 66 SLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYF-KEHGWPSSTIF 144 (298)
Q Consensus 66 ~~k~viFD~DGTL~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~-~~~g~~~~~~~ 144 (298)
.|++|+||+||||+|+...+.++|.++++++|++..... ++....+.......... ....+.
T Consensus 2 ~i~a~iFD~DGTL~dt~~~~~~a~~~~~~~~g~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~----- 64 (218)
T d1te2a_ 2 QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRN------------ELPDTLGLRIDMVVDLWYARQPWN----- 64 (218)
T ss_dssp CCCEEEECCBTTTBCCHHHHHHHHHHHHHHTTCCGGGGG------------GSCCCTTCCHHHHHHHHHHHSCCS-----
T ss_pred cceEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCHHH------------HHHHHhCCCccchhhhhhhccccc-----
Confidence 589999999999999999899999999999987653311 11222233322222222 222211
Q ss_pred CCCCCCChhHHHHHHHHHHHHHHHHHHHHhcCCCCCChhHHHHHHHHHHCCCeEEEEeCCChhhHHHHHHHHhCCccccC
Q 022348 145 DNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEG 224 (298)
Q Consensus 145 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~~~l~~L~~~g~~i~i~S~~~~~~~~~~l~~~~~l~~~~~ 224 (298)
.....++.+.+.+...+.+.. ...++||+.++|+.|+++|++++|+||+....+...++.+ ++..+
T Consensus 65 ------~~~~~~~~~~~~~~~~~~~~~-----~~~~~pg~~~~l~~L~~~g~~~~i~T~~~~~~~~~~l~~~-~l~~~-- 130 (218)
T d1te2a_ 65 ------GPSRQEVVERVIARAISLVEE-----TRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMF-DLRDS-- 130 (218)
T ss_dssp ------SSCHHHHHHHHHHHHHHHHHH-----HCCBCTTHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHHT-TCGGG--
T ss_pred ------chhHHHHHHHHHHHHHHhhhc-----cccccchHHHHHHHhhhccccccccccccccccccccccc-ccccc--
Confidence 112222233333333232222 2468999999999999999999999999999999999998 99988
Q ss_pred cceEEeCCCCCCCCCCHHHHHHHHHHhCCCCCcEEEEecChhhHHHHHHcCCeEEEEcCCCchhHhh
Q 022348 225 LDCFLAGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQVR 291 (298)
Q Consensus 225 fd~v~~~~~~~~~KP~~~~~~~~~~~lgi~~~~~~~vgD~~~Di~~a~~aG~~~v~~~~~~~~~~~~ 291 (298)
|+.++++++++.+||+|++|+.+++++|++|++|+||||+.+|+.+|+++|+.+|++.++....+..
T Consensus 131 F~~i~~~~~~~~~Kp~~~~~~~~~~~l~~~~~~~l~igD~~~di~aA~~~G~~~i~v~~~~~~~~~~ 197 (218)
T d1te2a_ 131 FDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPR 197 (218)
T ss_dssp CSEEEECTTSSCCTTSTHHHHHHHHHHTSCGGGEEEEESSHHHHHHHHHTTCEEEECCCTTTTTCGG
T ss_pred ccccccccccccchhhHHHHHHHHHHcCCCchhcEEEeeCHHHHHHHHHcCCEEEEECCCCCccchh
Confidence 9999999999999999999999999999999999999999999999999999999887765554433
|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|