Citrus Sinensis ID: 022372

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30

MVCQILWAYCLILTISNGAYCVICYDNDNQSCPCLTGIDPKIQLIVTPEVEAMDKKRSTLKISSSSVLAERSWSGSGVNKNKAMVEHLQHYGVITSKKVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVVSSIQNIEKSAAAPLLKEGSLSVHVGDGRKGWPEFAPYDAIHVGAAAPEIPQALIDQLKPGGRMVIPVGNIFQDLKVVDKNQDGSLSIWSETSVRYVPLTSRDAQLRGW

cHHHHHHHHHHHEEEEcccEEEEEEccccccccccccccccccccccccccccccccccHHccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccEEEEccccccccHHHHHccccccEEEEEEccccEEEEEEEEcccccEEEEECccEEEEcccccccccccc

*VCQILWAYCLILTISNGAYCVICYDNDNQSCPCLTGIDPKIQLIVTPEV*******************************KAMVEHLQHYGVITSKKVSEVMETIDRACFVPDGTPPYVDSPMAIGYNATISAPHMHATCLQLLEENLKPGMHALDIGSGTGYLTACFALMVGPQGRAVGVEHIPELVVSSIQNIEKSAAAPLLKEGSLSVHVGDGRKGWPEFAPYDAIHVGAAAPEIPQALIDQLKPGGRMVIPVGNIFQDLKVVDKNQDGSLSIWSETSVRYVPLTSRD******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein-L-isoaspartate O-methyltransferase	Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues.	probable	Q42539
Protein-L-isoaspartate(D-aspartate) O-methyltransferase	Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein.	probable	P22062
Protein-L-isoaspartate(D-aspartate) O-methyltransferase	Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.	probable	Q92047

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.1.-.-	Transferring one-carbon groups.	probable
2.1.1.-	15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).	probable
2.1.1.77	Transferred entry: 2.1.1.77, 2.1.1.80 and 2.1.1.100.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I1N, chain A
Confidence level:very confident
Coverage over the Query: 73-298
View the alignment between query and template
View the model in PyMOL