Citrus Sinensis ID: 022411


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDTLLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSGVA
cccccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccEEEEEEEccccccccHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHcccHHHHHcccccccccCEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHHHccccc
*******SAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIK********LQVDDDSDLIDEDTLLTEEDLK********DCEVGSTRKACKNCICGRAEAEEKVEKLGLT*D**KNPQSACGMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKF***********IVSG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDTLLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSGVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anamorsin homolog May be required for the maturation of extramitochondrial Fe/S proteins (By similarity). Has anti-apoptotic effects in the cell.probableD1I234
Anamorsin homolog May be required for the maturation of extramitochondrial Fe/S proteins (By similarity). Has anti-apoptotic effects in the cell.probableA9PBH9
Anamorsin homolog 1 May be required for the maturation of extramitochondrial Fe/S proteins (By similarity). Has anti-apoptotic effects in the cell.probableQ7XQ97

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LD4, chain A
Confidence level:very confident
Coverage over the Query: 4-154
View the alignment between query and template
View the model in PyMOL