Citrus Sinensis ID: 022411
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 297 | ||||||
| 225425061 | 276 | PREDICTED: anamorsin homolog [Vitis vini | 0.841 | 0.905 | 0.662 | 2e-84 | |
| 292630750 | 272 | RecName: Full=Anamorsin homolog; AltName | 0.824 | 0.900 | 0.664 | 7e-83 | |
| 292630769 | 277 | RecName: Full=Anamorsin homolog; AltName | 0.841 | 0.902 | 0.629 | 2e-79 | |
| 118483629 | 277 | unknown [Populus trichocarpa] | 0.841 | 0.902 | 0.629 | 2e-79 | |
| 255537095 | 274 | Anamorsin, putative [Ricinus communis] g | 0.835 | 0.905 | 0.608 | 7e-78 | |
| 224082520 | 266 | predicted protein [Populus trichocarpa] | 0.804 | 0.898 | 0.612 | 2e-74 | |
| 356543201 | 267 | PREDICTED: anamorsin homolog [Glycine ma | 0.811 | 0.902 | 0.581 | 7e-71 | |
| 388497454 | 274 | unknown [Lotus japonicus] | 0.835 | 0.905 | 0.589 | 1e-70 | |
| 147771846 | 279 | hypothetical protein VITISV_035762 [Viti | 0.781 | 0.831 | 0.595 | 3e-70 | |
| 357477471 | 441 | U11/U12 small nuclear ribonucleoprotein | 0.764 | 0.514 | 0.600 | 5e-69 |
| >gi|225425061|ref|XP_002271546.1| PREDICTED: anamorsin homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 318 bits (815), Expect = 2e-84, Method: Compositional matrix adjust.
Identities = 171/258 (66%), Positives = 199/258 (77%), Gaps = 8/258 (3%)
Query: 1 MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSI 60
MDT +Q++ LAL++ ++L +S VL+A+R L + V+QCDP IITQASSLSQLPVES S+
Sbjct: 1 MDTKMLQNSTLALTDHEVLSISTVLDAVRKLDNAGVDQCDPLIITQASSLSQLPVESSSL 60
Query: 61 DTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGF 120
D V+SI S E P D+LL EISRVLKPGGT+LI K S G D S LE KLL+AGF
Sbjct: 61 DIVISICRSLEFPCDKLLAEISRVLKPGGTVLIQKTSQSVAGIKDGETS-LERKLLMAGF 119
Query: 121 LDAQRIQLKSVVPAE-VVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDT 179
L+AQ IQLK VVP+E SFG+K KKP+WKIGSSF+IKKA KSL K Q++DD DLIDED+
Sbjct: 120 LEAQAIQLKPVVPSEGAQSFGIKAKKPSWKIGSSFSIKKAEKSLPKFQIEDDMDLIDEDS 179
Query: 180 LLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGM 239
LLTEEDLKKPQLP GDCEVGSTRKACKNC CGRAE EEKVEKLGLTMDQL NPQSACG
Sbjct: 180 LLTEEDLKKPQLPVDGDCEVGSTRKACKNCTCGRAEEEEKVEKLGLTMDQLNNPQSACGS 239
Query: 240 W----TWRC--FPLRYMP 251
+RC P + +P
Sbjct: 240 CGLGDAFRCGTCPYKGLP 257
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|292630750|sp|D1I234.1|DRE2_VITVI RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|297738244|emb|CBI27445.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|292630769|sp|A9PBH9.1|DRE2_POPTR RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|118483677|gb|ABK93732.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118483629|gb|ABK93709.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255537095|ref|XP_002509614.1| Anamorsin, putative [Ricinus communis] gi|292630771|sp|B9RBT0.1|DRE2_RICCO RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|223549513|gb|EEF51001.1| Anamorsin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224082520|ref|XP_002306726.1| predicted protein [Populus trichocarpa] gi|222856175|gb|EEE93722.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356543201|ref|XP_003540051.1| PREDICTED: anamorsin homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388497454|gb|AFK36793.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|147771846|emb|CAN71337.1| hypothetical protein VITISV_035762 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357477471|ref|XP_003609021.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein [Medicago truncatula] gi|355510076|gb|AES91218.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 297 | ||||||
| TAIR|locus:2146178 | 272 | AT5G18400 [Arabidopsis thalian | 0.885 | 0.966 | 0.435 | 2.6e-54 | |
| TAIR|locus:4515103586 | 182 | AT5G18362 "AT5G18362" [Arabido | 0.370 | 0.604 | 0.441 | 3.9e-21 | |
| UNIPROTKB|Q6FI81 | 312 | CIAPIN1 "Anamorsin" [Homo sapi | 0.518 | 0.493 | 0.268 | 4.4e-13 | |
| UNIPROTKB|Q5EAC7 | 310 | CIAPIN1 "Anamorsin" [Bos tauru | 0.518 | 0.496 | 0.262 | 8.1e-13 | |
| UNIPROTKB|E2RTJ0 | 315 | CIAPIN1 "Uncharacterized prote | 0.474 | 0.447 | 0.272 | 8.3e-12 | |
| MGI|MGI:1922083 | 309 | Ciapin1 "cytokine induced apop | 0.525 | 0.504 | 0.259 | 1.8e-11 | |
| UNIPROTKB|I3L704 | 313 | CIAPIN1 "Uncharacterized prote | 0.245 | 0.233 | 0.395 | 3.6e-11 | |
| DICTYBASE|DDB_G0285251 | 256 | rsc43 "Protein DRE2" [Dictyost | 0.639 | 0.742 | 0.296 | 9e-11 | |
| UNIPROTKB|Q5ZJA2 | 306 | CIAPIN1 "Anamorsin" [Gallus ga | 0.457 | 0.444 | 0.254 | 5e-10 | |
| UNIPROTKB|F1P0W1 | 305 | CIAPIN1 "Anamorsin" [Gallus ga | 0.457 | 0.445 | 0.254 | 1.5e-09 |
| TAIR|locus:2146178 AT5G18400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 561 (202.5 bits), Expect = 2.6e-54, P = 2.6e-54
Identities = 118/271 (43%), Positives = 171/271 (63%)
Query: 1 MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSI 60
MD+ Q VLA+++D +LPVS+VL +++LG E +E DP IITQAS+++Q P+++ S+
Sbjct: 1 MDSMMNQKTVLAVTDDVVLPVSSVLAIMKELGKEVIESFDPLIITQASTINQFPLDASSV 60
Query: 61 DTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGF 120
+ VL+IS + + P D++ E SR+LKPGGT+ + K L + G++ + I + ++ LAGF
Sbjct: 61 EAVLAISKTSDFPSDKICGEFSRILKPGGTVSVCKVLEGETGEIQQTI---QRRVTLAGF 117
Query: 121 LDAQRIQLKSV-VPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVXXXXXXXXXXX 179
L+ Q + LKS+ + +SFG+K KKP+WKIGSSFA+KK +L K+ +
Sbjct: 118 LEPQCLDLKSIKLSTFSLSFGIKAKKPSWKIGSSFALKKPVTNLFKIDLDDDVDLIDEDS 177
Query: 180 XXXXXXXKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGM 239
KPQLP CE +T+KACKNC+CGRAE EEK KLGLT DQ++NPQS+CG
Sbjct: 178 LLTEEDLMKPQLPVASGCE--TTKKACKNCVCGRAEIEEKAVKLGLTEDQIENPQSSCGS 235
Query: 240 W-TWRCFPLRYMPLQGSASIQTGREGVTVKQ 269
F P +G + G E VT+ Q
Sbjct: 236 CGLGDAFRCGTCPYKGLPPFKLG-EKVTLSQ 265
|
|
| TAIR|locus:4515103586 AT5G18362 "AT5G18362" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6FI81 CIAPIN1 "Anamorsin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EAC7 CIAPIN1 "Anamorsin" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RTJ0 CIAPIN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1922083 Ciapin1 "cytokine induced apoptosis inhibitor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L704 CIAPIN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285251 rsc43 "Protein DRE2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJA2 CIAPIN1 "Anamorsin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P0W1 CIAPIN1 "Anamorsin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 297 | |||
| pfam05093 | 97 | pfam05093, CIAPIN1, Cytokine-induced anti-apoptosi | 1e-11 | |
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 3e-08 | |
| COG5636 | 284 | COG5636, COG5636, Uncharacterized conserved protei | 3e-07 |
| >gnl|CDD|218427 pfam05093, CIAPIN1, Cytokine-induced anti-apoptosis inhibitor 1, Fe-S biogenesis | Back alignment and domain information |
|---|
Score = 59.7 bits (145), Expect = 1e-11
Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 13/68 (19%)
Query: 184 EDLKKPQLPSV--GDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQ-----------L 230
EDLKKP ++ G RKACKNC CG AE EE+ +K Q +
Sbjct: 1 EDLKKPDPVTLRKCGPGPGKKRKACKNCTCGLAEEEEQEKKDKSAAQQQKVEDDLAEITV 60
Query: 231 KNPQSACG 238
+ S+CG
Sbjct: 61 EGKTSSCG 68
|
Anamorsin, subsequently named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1, in humans is the homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis. It is found in both the cytoplasm and in the mitochondrial intermembrane space (IMS). CIAPIN1 is found to be up-regulated in hepatocellular cancer, is considered to be a downstream effector of the receptor tyrosine kinase-Ras signalling pathway, and is essential in mouse definitive haematopoiesis. Dre2 has been found to interact with the yeast reductase Tah18, forming a tight cytosolic complex implicated in the response to high levels of oxidative stress. Length = 97 |
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227923 COG5636, COG5636, Uncharacterized conserved protein, contains Zn-ribbon-like motif [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| KOG4020 | 257 | consensus Protein DRE2, required for cell viabilit | 100.0 | |
| PF05093 | 100 | CIAPIN1: Cytokine-induced anti-apoptosis inhibitor | 100.0 | |
| COG5636 | 284 | Uncharacterized conserved protein, contains Zn-rib | 100.0 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.41 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.32 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 99.25 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.17 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 99.16 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.13 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 99.1 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 98.98 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 98.89 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 98.89 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 98.85 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 98.83 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.75 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 98.69 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 98.66 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 98.58 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 98.53 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 98.5 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 98.5 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 98.47 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 98.46 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 98.4 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 98.4 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 98.39 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 98.37 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 98.32 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 98.29 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 98.29 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 98.29 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 98.28 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 98.27 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 98.26 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 98.23 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 98.2 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 98.19 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 98.19 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 98.19 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 98.16 | |
| PRK04266 | 226 | fibrillarin; Provisional | 98.12 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 98.12 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 98.11 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 98.11 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 98.11 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 98.09 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 98.06 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 98.01 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 98.01 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 98.0 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 97.99 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 97.97 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 97.97 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 97.87 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 97.84 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 97.83 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 97.82 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 97.78 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 97.77 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 97.68 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 97.65 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 97.65 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 97.63 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 97.61 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 97.58 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 97.57 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 97.54 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 97.51 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 97.49 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 97.49 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 97.47 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 97.46 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 97.46 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 97.45 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 97.42 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 97.41 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 97.39 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 97.37 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 97.34 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.3 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 97.3 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 97.29 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 97.2 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 97.09 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 97.07 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.05 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 97.04 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 97.04 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 97.03 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 96.99 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 96.95 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.9 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 96.89 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 96.88 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 96.87 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 96.83 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 96.78 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 96.77 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 96.71 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 96.67 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 96.66 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 96.66 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 96.59 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 96.57 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 96.56 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 96.55 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 96.52 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 96.5 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 96.47 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 96.47 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 96.46 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 96.45 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 96.43 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 96.39 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 96.35 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 96.35 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 96.31 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 96.3 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 96.28 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 96.27 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.2 | |
| COG4627 | 185 | Uncharacterized protein conserved in bacteria [Fun | 96.14 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 96.06 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 96.06 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 96.05 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 96.04 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 95.92 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 95.91 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 95.88 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 95.81 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 95.68 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 95.52 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 95.52 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 95.51 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 95.41 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 95.37 | |
| PLN02366 | 308 | spermidine synthase | 95.36 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 95.33 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 95.32 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 95.09 | |
| PF06859 | 110 | Bin3: Bicoid-interacting protein 3 (Bin3); InterPr | 95.01 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 94.92 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 94.9 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 94.57 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 94.5 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 94.42 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 94.42 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 94.32 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 94.26 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 94.24 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 94.15 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 93.96 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 93.94 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 93.93 | |
| COG4798 | 238 | Predicted methyltransferase [General function pred | 93.74 | |
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 93.7 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 93.7 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 93.28 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 93.21 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 92.92 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 92.91 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 92.5 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 92.4 | |
| PRK13699 | 227 | putative methylase; Provisional | 92.39 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 92.3 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 91.96 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 91.83 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 91.78 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 91.65 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 91.59 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 91.5 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 91.46 | |
| PF03269 | 177 | DUF268: Caenorhabditis protein of unknown function | 91.04 | |
| PLN02823 | 336 | spermine synthase | 90.71 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 90.66 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 90.24 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 89.85 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 89.51 | |
| PLN02476 | 278 | O-methyltransferase | 88.98 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 88.91 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 88.12 | |
| PF05430 | 124 | Methyltransf_30: S-adenosyl-L-methionine-dependent | 88.1 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 87.59 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 87.29 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 86.92 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 86.8 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 86.36 | |
| COG1889 | 231 | NOP1 Fibrillarin-like rRNA methylase [Translation, | 86.21 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 85.74 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 85.29 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 85.22 | |
| KOG3201 | 201 | consensus Uncharacterized conserved protein [Funct | 84.1 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 83.26 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 83.21 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 82.48 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 82.12 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 81.37 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 80.26 |
| >KOG4020 consensus Protein DRE2, required for cell viability [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-43 Score=309.23 Aligned_cols=233 Identities=29% Similarity=0.361 Sum_probs=148.1
Q ss_pred EEeecCCccChHHHHHHHHHHHHHHhhhc--CCCeEEEEccCCCCCCCCCcccEEEeccccCCCChHHHHHHHHhcccCC
Q 022411 11 LALSEDKILPVSAVLNAIRDLGDEAVEQC--DPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPG 88 (297)
Q Consensus 11 Lll~~~~~vt~~dlse~m~~~A~~~~~~~--~~~v~~~~~d~~~Lp~~d~sfD~Vls~~~~~~~~~~~~L~ei~RvLKPG 88 (297)
|++.+. ..+.....+-...++.-.+... ...+..+.+....+ +.++||+.+... .|.....+....+..|+|+
T Consensus 4 l~~~l~-~~~~~~~~~~~K~~~~i~~~~ggdl~li~~~~~~~~t~--~~~~~e~~~~e~--a~~~~~~V~~l~~~~l~P~ 78 (257)
T KOG4020|consen 4 LLLCLT-GTTTSELAELLKAQALIKAVKGGDLFLINKVNGSVSTL--ENARYELLTPEA--ATLSGLKVKSLLRASLKPE 78 (257)
T ss_pred eeEEec-ccchhhHHHHHHhHHhhhcccCcchhheeccccccccc--cccceeccchhh--ccccccchhhhhhcccCcc
Confidence 334344 4445566665555554322211 23344445555544 478899554433 2333125666777899999
Q ss_pred cEEEEEecCCCCccchHHHHHHHHHHHHHCCcccccchhccccCc--cceeEeeeeecCCCCCCCCccccccCcc-----
Q 022411 89 GTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVP--AEVVSFGVKGKKPTWKIGSSFAIKKAPK----- 161 (297)
Q Consensus 89 G~l~i~~~~~~~~g~~~~~~~~l~~~L~laGFv~v~~~~~kp~~~--~~~~~~~i~akKP~~~~gs~~~~~~~~~----- 161 (297)
|.+.+.++... - ..+.....+.|+.++. |.++... +.+ |+.....|++.++.+.+
T Consensus 79 gtl~v~s~~g~----~----~~~l~~~~i~g~~~~~--~~s~d~~s~~ql--------kl~~~K~ss~~~q~a~k~~~~k 140 (257)
T KOG4020|consen 79 GTLSVLSHIGH----A----DDLLLFVKITGEKDYC--WISPDVSSANQL--------KLSITKKSSPSLQSASKNAAAK 140 (257)
T ss_pred ceEehhhhccc----h----hhHHHHHHHhCCcccc--ccCccccccccc--------cccceeccCcccccccccHHHH
Confidence 99998776421 1 1455567888888763 2222211 111 33333334433332221
Q ss_pred cccc-----cccCCCCCccCcCCCCCccccCCCCCCCCC-CCCCCCCccCCCCCccchHHHHHHHHhcCCCccccCCCCC
Q 022411 162 SLAK-----LQVDDDSDLIDEDTLLTEEDLKKPQLPSVG-DCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQS 235 (297)
Q Consensus 162 ~~~~-----~~~ddd~dlIded~Ll~e~d~~~p~~~~~~-~C~~~~krkACknCtCGlaE~e~~~~~~~~~~~~~~~~~s 235 (297)
..|. +.+|.++|+||||+||+|||+.+|+..+.. .|++++||||||||||||||+||.|.. ......+++|
T Consensus 141 nl~s~sand~s~d~~~dlide~elldee~~~k~~~~~~~a~~~~~kKkkaCk~CtcGl~Ee~E~Eks---~~q~s~~~~s 217 (257)
T KOG4020|consen 141 NLWSLSANDMSDDLRQDLIDEEELLDEEDLKKPDPASLRASCSPGKKKKACKNCTCGLAEEEEKEKS---REQISSNPKS 217 (257)
T ss_pred HhhhhhccccccchhhhccChhhccCHhhcCCCCccccccCCCCcccchhhhcCCcccHHHHHhhhh---hhhhccCccc
Confidence 1222 223445799999999999999999887755 899999999999999999999997642 2233456999
Q ss_pred CCCcc----ccccCCCCCCCCCCCCCCCCCCCCceEeecCCcce
Q 022411 236 ACGMW----TWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRH 275 (297)
Q Consensus 236 sCGnC----AFRC~~CPYlGlPaF~~~~~~~~~~~~~~~~~~~~ 275 (297)
+|||| ||||+|||||||||||| |++|.+-+++-+
T Consensus 218 ~CGnCylGdaFrCs~CPylG~PafkP------Ge~v~ls~~~~~ 255 (257)
T KOG4020|consen 218 ACGNCYLGDAFRCSGCPYLGMPAFKP------GEKVLLSDNSDK 255 (257)
T ss_pred ccCcccccccceecCCCcCCCCCCCC------CCeEEecccccc
Confidence 99999 99999999999999985 466766555443
|
|
| >PF05093 CIAPIN1: Cytokine-induced anti-apoptosis inhibitor 1, Fe-S biogenesis; InterPro: IPR007785 Anamorsin, subsequently named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1, in humans is the homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis | Back alignment and domain information |
|---|
| >COG5636 Uncharacterized conserved protein, contains Zn-ribbon-like motif [Function unknown] | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4627 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >COG4798 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3201 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 297 | ||||
| 2ld4_A | 176 | Solution Structure Of The N-Terminal Domain Of Huma | 4e-05 | ||
| 2yui_A | 182 | Solution Structure Of The N-Terminal Domain In Huma | 1e-04 |
| >pdb|2LD4|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Anamorsin Length = 176 | Back alignment and structure |
|
| >pdb|2YUI|A Chain A, Solution Structure Of The N-Terminal Domain In Human Cytokine-Induced Apoptosis Inhibitor Anamorsin Length = 182 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 297 | |||
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 2e-14 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 3e-09 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 3e-08 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 9e-07 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 3e-06 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 4e-06 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 1e-05 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 2e-05 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 2e-05 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 4e-05 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 4e-05 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 4e-05 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 5e-05 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 2e-04 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 2e-04 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 3e-04 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 4e-04 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 4e-04 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 5e-04 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 5e-04 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 5e-04 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 6e-04 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 6e-04 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 7e-04 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 9e-04 |
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Length = 176 | Back alignment and structure |
|---|
Score = 69.1 bits (168), Expect = 2e-14
Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 18/128 (14%)
Query: 44 ITQASSLSQLPVESFSIDTVLS--ISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSD- 100
+ L Q + S D +LS + S L ++L EI+R+L+PGG + + + + +
Sbjct: 48 VENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAV 107
Query: 101 -KGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAE--------------VVSFGVKGKK 145
K S L L L+G ++ + +Q + + P E ++ + GKK
Sbjct: 108 DNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKK 167
Query: 146 PTWKIGSS 153
P +++GSS
Sbjct: 168 PNFEVGSS 175
|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 99.72 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.2 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.03 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 98.99 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 98.98 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 98.96 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 98.92 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 98.9 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 98.9 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 98.89 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 98.89 | |
| 2km1_A | 136 | Protein DRE2; yeast, antiapoptotic, protein bindin | 98.89 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 98.89 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 98.87 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 98.86 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 98.85 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 98.83 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 98.83 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 98.83 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 98.81 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 98.81 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 98.8 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 98.8 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 98.79 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 98.78 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 98.77 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 98.76 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 98.75 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 98.74 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 98.74 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 98.73 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 98.72 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 98.71 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 98.7 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 98.7 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 98.7 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 98.69 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 98.69 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 98.68 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 98.66 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 98.64 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 98.62 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 98.61 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 98.59 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 98.59 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 98.57 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 98.56 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 98.56 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 98.56 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 98.55 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 98.55 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 98.54 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 98.54 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 98.53 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 98.53 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 98.51 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 98.49 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 98.49 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 98.48 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 98.47 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 98.47 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 98.46 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 98.45 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 98.44 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 98.43 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 98.42 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 98.41 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 98.39 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 98.39 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 98.39 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 98.38 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 98.37 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 98.37 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 98.36 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 98.36 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 98.36 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 98.36 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 98.34 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 98.34 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 98.32 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 98.32 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 98.28 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 98.28 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 98.27 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 98.25 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 98.25 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 98.24 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.22 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 98.2 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 98.2 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 98.2 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 98.2 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 98.19 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 98.18 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 98.16 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 98.15 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 98.14 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 98.14 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 98.12 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 98.1 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 98.09 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 98.07 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 98.06 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 98.06 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 98.05 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 98.05 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 98.04 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 98.03 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 98.02 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 98.02 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 98.01 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 98.01 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 98.0 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 97.99 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 97.97 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 97.97 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 97.97 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 97.96 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 97.94 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 97.94 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 97.93 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 97.93 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 97.9 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 97.9 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 97.87 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 97.87 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 97.85 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 97.85 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 97.84 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 97.82 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 97.82 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 97.81 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 97.8 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 97.79 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 97.79 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 97.78 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 97.77 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 97.76 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 97.75 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 97.75 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.74 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 97.72 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 97.72 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 97.71 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 97.68 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 97.66 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 97.66 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 97.66 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 97.65 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 97.63 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 97.63 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 97.61 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.61 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 97.6 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 97.6 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 97.58 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.58 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 97.58 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 97.56 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 97.55 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 97.55 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 97.52 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.52 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 97.5 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 97.5 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 97.5 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 97.49 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 97.48 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 97.48 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 97.47 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 97.45 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 97.44 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 97.42 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 97.42 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 97.42 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 97.39 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 97.35 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 97.34 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 97.32 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 97.29 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 97.28 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 97.27 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 97.27 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 97.22 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 97.21 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 97.18 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 97.17 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 97.17 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 97.16 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 97.16 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 97.12 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 97.11 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 97.1 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 97.1 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 97.07 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 97.06 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 97.05 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 97.03 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 96.99 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 96.95 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 96.94 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 96.92 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 96.87 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 96.85 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 96.84 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 96.83 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 96.83 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 96.82 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 96.81 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 96.81 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 96.8 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 96.79 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 96.7 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.65 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 96.65 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 96.65 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 96.61 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 96.6 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 96.53 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 96.52 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.51 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 96.48 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 96.4 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 96.38 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 96.38 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 96.36 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 96.33 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 96.33 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.31 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 96.3 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 96.28 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 96.17 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 96.07 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 96.04 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 96.04 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 96.0 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 95.97 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 95.94 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 95.87 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 95.87 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 95.83 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 95.81 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 95.8 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 95.7 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 95.63 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 95.58 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 95.57 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 95.4 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 95.33 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 95.29 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 94.84 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 94.83 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 94.64 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 94.46 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 94.41 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 94.35 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 94.01 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 93.12 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 92.79 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 92.72 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 91.97 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 91.72 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 90.71 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 90.63 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 90.29 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 90.14 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 89.53 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 89.11 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 88.2 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 87.99 | |
| 3vyw_A | 308 | MNMC2; tRNA wobble uridine, modification enzyme, g | 86.95 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 86.65 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 86.3 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 86.21 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 85.82 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 84.7 |
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
Probab=99.72 E-value=4.3e-17 Score=137.87 Aligned_cols=146 Identities=22% Similarity=0.319 Sum_probs=109.5
Q ss_pred cccCceEEEeecCCccChHHHHHHHHHHHHHHhhhcCCCeEEEEccCCCCCC---CCCcccEEEeccccCCC-C-hHHHH
Q 022411 4 GKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPV---ESFSIDTVLSISSSHEL-P-GDQLL 78 (297)
Q Consensus 4 ~~~~~~VLll~~~~~vt~~dlse~m~~~A~~~~~~~~~~v~~~~~d~~~Lp~---~d~sfD~Vls~~~~~~~-~-~~~~L 78 (297)
++.|++||.|+.+.+. .|+++.|++.|+++... ++.+++++++.+++ ++++||+|++..++||+ + ...++
T Consensus 10 ~~~g~~vL~~~~g~v~--vD~s~~ml~~a~~~~~~---~~~~~~~d~~~~~~~~~~~~~fD~V~~~~~l~~~~~~~~~~l 84 (176)
T 2ld4_A 10 ISAGQFVAVVWDKSSP--VEALKGLVDKLQALTGN---EGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEIL 84 (176)
T ss_dssp CCTTSEEEEEECTTSC--HHHHHHHHHHHHHHTTT---TSEEEEEEGGGGGGGCCCSSCEEEEEECCSTTCCCCCCHHHH
T ss_pred CCCCCEEEEecCCcee--eeCCHHHHHHHHHhccc---CcEEEEechhcCccccCCCCCEeEEEECChhhhcccCHHHHH
Confidence 4678999999998865 99999999999876532 48999999999988 89999999999999998 5 78999
Q ss_pred HHHHhcccCCcEEEEEecCCCCcc--chHHHHHHHHHHHHHCCcccccchhccccCc--------------cceeEeeee
Q 022411 79 EEISRVLKPGGTILIYKKLTSDKG--DVDKAISALEGKLLLAGFLDAQRIQLKSVVP--------------AEVVSFGVK 142 (297)
Q Consensus 79 ~ei~RvLKPGG~l~i~~~~~~~~g--~~~~~~~~l~~~L~laGFv~v~~~~~kp~~~--------------~~~~~~~i~ 142 (297)
++++|+|||||+|++..+.....+ ......+++...|..+||+++.....-|..+ +.+..+.+.
T Consensus 85 ~~~~r~LkpgG~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGfi~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~ 164 (176)
T 2ld4_A 85 AEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQIT 164 (176)
T ss_dssp HHHHHHEEEEEEEEEEEEEESSSCSSSSSCCHHHHHHHHHHTTCEEEEEEEEECCCHHHHHHHHHHTCCCCSSEEEEEEE
T ss_pred HHHHHHCCCCEEEEEEcccccccccccccCCHHHHHHHHHHCCCcEeecCcccCCCHHHHHHHHHHhcccCCceEEEEEe
Confidence 999999999999999765321111 0111234788899999995433221111111 122356789
Q ss_pred ecCCCCCCCCcc
Q 022411 143 GKKPTWKIGSSF 154 (297)
Q Consensus 143 akKP~~~~gs~~ 154 (297)
++||+|++|||+
T Consensus 165 a~Kp~~~~gs~~ 176 (176)
T 2ld4_A 165 GKKPNFEVGSSR 176 (176)
T ss_dssp EECCCSSCCSCC
T ss_pred ccCCcccccCCC
Confidence 999999999984
|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 297 | ||||
| d2g72a1 | 263 | c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr | 2e-04 | |
| d2i6ga1 | 198 | c.66.1.44 (A:1-198) Putative methyltransferase Teh | 0.001 | |
| d1ve3a1 | 226 | c.66.1.43 (A:2-227) Hypothetical protein PH0226 {A | 0.004 |
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Arylamine N-methyltransferase domain: Phenylethanolamine N-methyltransferase, PNMTase species: Human (Homo sapiens) [TaxId: 9606]
Score = 39.4 bits (91), Expect = 2e-04
Identities = 20/103 (19%), Positives = 33/103 (32%), Gaps = 9/103 (8%)
Query: 8 SAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSIS 67
S L E K +R + V D + Q L D ++S
Sbjct: 110 SQHACLIEGKGECWQDKERQLRARV-KRVLPID---VHQPQPLGAGSPAPLPADALVSAF 165
Query: 68 SSHELPGD-----QLLEEISRVLKPGGTILIYKKLTSDKGDVD 105
+ D + L+ I+ +L+PGG +L+ L
Sbjct: 166 CLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAG 208
|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 226 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.3 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.21 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.08 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.0 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 98.99 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 98.95 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 98.94 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 98.86 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 98.75 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 98.74 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 98.66 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 98.66 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 98.63 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 98.59 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 98.56 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 98.46 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 98.45 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 98.44 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 98.41 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 98.38 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 98.3 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 98.26 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 98.26 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 98.2 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 98.16 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 98.13 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 98.11 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 98.09 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 98.08 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 98.07 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 98.04 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 98.0 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 98.0 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 98.0 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 97.98 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.97 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 97.88 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 97.82 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 97.8 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 97.76 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 97.68 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 97.59 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 97.52 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 97.43 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 97.4 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 97.34 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 97.13 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 97.04 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 96.98 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 96.91 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 96.74 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 96.64 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 96.6 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 95.86 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 95.73 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 95.67 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 95.22 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 95.04 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 94.79 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 94.2 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 94.12 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 93.71 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 93.49 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 93.17 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 90.94 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 90.91 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 90.46 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 90.05 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 89.4 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 89.2 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 89.15 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 88.91 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 88.59 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 87.67 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 87.27 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 85.83 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 85.08 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 84.86 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 84.24 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 83.92 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 83.91 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 83.57 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 80.41 |
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: UbiE/COQ5-like domain: Hypothetical protein BH2331 species: Bacillus halodurans [TaxId: 86665]
Probab=99.30 E-value=1.4e-12 Score=112.15 Aligned_cols=121 Identities=21% Similarity=0.228 Sum_probs=90.8
Q ss_pred cccCceEEEeecCC------------ccChHHHHHHHHHHHHHHhhhc-CCCeEEEEccCCCCCCCCCcccEEEeccccC
Q 022411 4 GKMQSAVLALSEDK------------ILPVSAVLNAIRDLGDEAVEQC-DPQIITQASSLSQLPVESFSIDTVLSISSSH 70 (297)
Q Consensus 4 ~~~~~~VLll~~~~------------~vt~~dlse~m~~~A~~~~~~~-~~~v~~~~~d~~~Lp~~d~sfD~Vls~~~~~ 70 (297)
++.|.+||-|--|+ .++..|+++.|++.|++++... .+++.+++++++.+||++++||+|++..++|
T Consensus 13 l~~~~rVLDiGcG~G~~~~~l~~~~~~v~gvD~s~~~i~~A~~~~~~~~~~~i~~~~~d~~~l~~~~~~fD~v~~~~~l~ 92 (231)
T d1vl5a_ 13 LKGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAH 92 (231)
T ss_dssp CCSCCEEEEETCTTCHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHTTCCSEEEEECCC-CCCSCTTCEEEEEEESCGG
T ss_pred CCCcCEEEEecccCcHHHHHHHHhCCEEEEEECCHHHHhhhhhccccccccccccccccccccccccccccccccccccc
Confidence 34556666664433 3445688999999998876543 6789999999999999999999999999999
Q ss_pred CCC-hHHHHHHHHhcccCCcEEEEEecCCCCccchHH-----------------HHHHHHHHHHHCCccccc
Q 022411 71 ELP-GDQLLEEISRVLKPGGTILIYKKLTSDKGDVDK-----------------AISALEGKLLLAGFLDAQ 124 (297)
Q Consensus 71 ~~~-~~~~L~ei~RvLKPGG~l~i~~~~~~~~g~~~~-----------------~~~~l~~~L~laGFv~v~ 124 (297)
|++ +..++++++|+|||||+|++.++.......+.. ..+++.+.|..+||..++
T Consensus 93 ~~~d~~~~l~~~~r~LkpgG~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf~~~~ 164 (231)
T d1vl5a_ 93 HFPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEE 164 (231)
T ss_dssp GCSCHHHHHHHHHHHEEEEEEEEEEEEEBCSSHHHHHHHHHHHHHHCTTCCCCCBHHHHHHHHHHHTCEEEE
T ss_pred ccCCHHHHHHHHHHhcCCCcEEEEEeCCCCCCHHHHHHHHHHHhhcccCcccCCCHHHHHHHHHHCCCEEEE
Confidence 997 889999999999999999998764322111111 014566778888997654
|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|