Citrus Sinensis ID: 022459

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MGDIAKDLFSGTVGGAAQLICGHPFDTIKVKLQSQPAPLPGQPPKYAGAMDAVKQTIAAEGPRGLYKGMGAPLATVAAFNALLFTVRGQMEALLRSQPGAPLTVNQQIICGAGAGVAVSFLACPTELIKCRLQAQSALAGSGQVGVAVKYGGPVDVAKRVLRSEGGLRGLFKGLVPTMAREVPGNAAMFGVYELVKQYMAGGQDTSQLGRGAVLLAGGLSGACFWFSVYPTDVVKSVIQVDDYKNPKFSGSIDAFKKILKSEGVKGLYKGFTPAMARSVPANAACFLAYEVTRSSLG
ccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHcccccccEEEccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccHHHHHHccccHHHHHHHHHHHHHHcc
**DIAKDLFSGTVGGAAQLICGHPFDTIKVKLQSQP********KYAGAMDAVKQTIAAEGPRGLYKGMGAPLATVAAFNALLFTVRGQMEALLRSQPGAPLTVNQQIICGAGAGVAVSFLACPTELIKCRLQAQSALAGS******VKYGGPVDVAKRVLRSEGGLRGLFKGLVPTMAREVPGNAAMFGVYELVKQYMAGGQDTSQLGRGAVLLAGGLSGACFWFSVYPTDVVKSVIQVDDYKNPKFSGSIDAFKKILKSEGVKGLYKGFTPAMARSVPANAACFLAYEVTRSSLG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDIAKDLFSGTVGGAAQLICGHPFDTIKVKLQSQPAPLPGQPPKYAGAMDAVKQTIAAEGPRGLYKGMGAPLATVAAFNALLFTVRGQMEALLRSQPGAPLTVNQQIICGAGAGVAVSFLACPTELIKCRLQAQSALAGSGQVGVAVKYGGPVDVAKRVLRSEGGLRGLFKGLVPTMAREVPGNAAMFGVYELVKQYMAGGQDTSQLGRGAVLLAGGLSGACFWFSVYPTDVVKSVIQVDDYKNPKFSGSIDAFKKILKSEGVKGLYKGFTPAMARSVPANAACFLAYEVTRSSLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial carnitine/acylcarnitine carrier-like protein May transport carnitine or acylcarnitine from the cytosol to the mitochondrial matrix as an alternative or a complement to the succinate-producing glyoxylate cycle. Involved in the transition from the embryonic stage to the juvenile autotrophic stage.confidentQ93XM7
Congested-like trachea protein Putative mitochondrial carrier of unknown solute specificity. Required for gas-filling of the tracheal system at hatching time of the embryo and for normal epithelial morphogenesis of the wings.probableQ9VQG4
Carrier protein YMC1, mitochondrial probableP32331

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 4-292
View the alignment between query and template
View the model in PyMOL