Citrus Sinensis ID: 022496


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MMLRASQLASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLLSELQRRVSQGREDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
cccHHcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccHEEEcccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHccHHcHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccccEEccccEEEHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccc
**********PVLCAITQSLIPTLNL*******IFQ**ASFASFYKSLNPASNSNSFHIHIISRSFTSPKA*****************EILVQHLLVKEDDLNLLSELQRRVSQGREDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLRASQLASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLxxxxxxxxxxxxxxxxxxxxxHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rhodanese-like/PpiC domain-containing protein 12 probableQ93WI0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YT8, chain A
Confidence level:very confident
Coverage over the Query: 186-292
View the alignment between query and template
View the model in PyMOL
Template: 1M5Y, chain A
Confidence level:very confident
Coverage over the Query: 4-182
View the alignment between query and template
View the model in PyMOL