Citrus Sinensis ID: 022496
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| 225436662 | 296 | PREDICTED: UPF0176 protein Pput_3956 [Vi | 0.966 | 0.966 | 0.704 | 1e-103 | |
| 356554167 | 291 | PREDICTED: UPF0176 protein Pput_3956-lik | 0.777 | 0.790 | 0.775 | 1e-103 | |
| 255639033 | 291 | unknown [Glycine max] | 0.777 | 0.790 | 0.771 | 1e-103 | |
| 358249358 | 292 | uncharacterized protein LOC100803404 [Gl | 0.777 | 0.787 | 0.767 | 1e-102 | |
| 357493891 | 649 | Peptidyl-prolyl cis-trans isomerase C [M | 0.962 | 0.439 | 0.647 | 1e-101 | |
| 388516905 | 291 | unknown [Medicago truncatula] | 0.962 | 0.979 | 0.647 | 1e-101 | |
| 449480987 | 292 | PREDICTED: LOW QUALITY PROTEIN: rhodanes | 0.966 | 0.979 | 0.637 | 1e-101 | |
| 255570207 | 294 | rotamase, putative [Ricinus communis] gi | 0.966 | 0.972 | 0.646 | 7e-99 | |
| 152955225 | 289 | parvulin-type peptidyl prolyl cis/trans | 0.780 | 0.799 | 0.758 | 3e-96 | |
| 224103965 | 296 | predicted protein [Populus trichocarpa] | 0.706 | 0.706 | 0.822 | 5e-94 |
| >gi|225436662|ref|XP_002276538.1| PREDICTED: UPF0176 protein Pput_3956 [Vitis vinifera] gi|296083867|emb|CBI24255.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 381 bits (979), Expect = e-103, Method: Compositional matrix adjust.
Identities = 215/305 (70%), Positives = 244/305 (80%), Gaps = 19/305 (6%)
Query: 2 MLRASQL---ASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPAS--NSNS 56
MLRA+ L ASP L A+ SLIPTLNL+S S I +K +SF+S + L P + S+
Sbjct: 1 MLRAAHLPPGASPALVALKLSLIPTLNLTSPS---IIRKFSSFSSLHAFL-PKTFLPSSP 56
Query: 57 FHIHIISRSFTSPKA-----ASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLLSELQRR 111
+ + + + F A ASFSSG G++ G REILVQHLLVKEDDL LL ELQ+R
Sbjct: 57 YPLSLGLKRFPPMVAQPCPRASFSSG--GNT--GSGREILVQHLLVKEDDLKLLLELQQR 112
Query: 112 VSQGREDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGW 171
+S G DLSDLAVE+SICPSK EGGMLGWVRKGQ+VPEFEE AF PLNKV RCKTKFGW
Sbjct: 113 ISGGV-DLSDLAVEYSICPSKEEGGMLGWVRKGQMVPEFEEAAFKAPLNKVVRCKTKFGW 171
Query: 172 HLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLR 231
HLLQV+SERE SLLQDIQP ELH KMQDPNF +E QLIDVREPEEVA +SLPGFQVLPL+
Sbjct: 172 HLLQVISEREESLLQDIQPVELHAKMQDPNFFEEVQLIDVREPEEVAQASLPGFQVLPLQ 231
Query: 232 QFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDP 291
QFG+WGP+IT KFDP+KDTY+MCHHGMRSLQVA+WLQTQGF+RVFNVSGGIHAYATK DP
Sbjct: 232 QFGNWGPEITTKFDPEKDTYLMCHHGMRSLQVAKWLQTQGFKRVFNVSGGIHAYATKADP 291
Query: 292 SIPTY 296
SIPTY
Sbjct: 292 SIPTY 296
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356554167|ref|XP_003545420.1| PREDICTED: UPF0176 protein Pput_3956-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255639033|gb|ACU19817.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358249358|ref|NP_001240041.1| uncharacterized protein LOC100803404 [Glycine max] gi|255636250|gb|ACU18465.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357493891|ref|XP_003617234.1| Peptidyl-prolyl cis-trans isomerase C [Medicago truncatula] gi|355518569|gb|AET00193.1| Peptidyl-prolyl cis-trans isomerase C [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388516905|gb|AFK46514.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449480987|ref|XP_004156048.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like/PpiC domain-containing protein 12-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255570207|ref|XP_002526064.1| rotamase, putative [Ricinus communis] gi|223534645|gb|EEF36341.1| rotamase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|152955225|emb|CAM59673.1| parvulin-type peptidyl prolyl cis/trans isomerase [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224103965|ref|XP_002313264.1| predicted protein [Populus trichocarpa] gi|222849672|gb|EEE87219.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| TAIR|locus:2150235 | 299 | AT5G19370 [Arabidopsis thalian | 0.695 | 0.688 | 0.660 | 2.8e-73 | |
| UNIPROTKB|Q607L7 | 106 | MCA1742 "Rhodanese-like domain | 0.358 | 1.0 | 0.392 | 1.1e-16 | |
| TIGR_CMR|CPS_3482 | 92 | CPS_3482 "peptidyl-prolyl cis- | 0.273 | 0.880 | 0.458 | 2.1e-13 | |
| TIGR_CMR|CPS_3636 | 92 | CPS_3636 "peptidyl-prolyl cis- | 0.273 | 0.880 | 0.447 | 2.1e-13 | |
| UNIPROTKB|P0A9L5 | 93 | ppiC "peptidyl-prolyl cis-tran | 0.273 | 0.870 | 0.447 | 3.4e-13 | |
| TIGR_CMR|SO_1832 | 92 | SO_1832 "peptidyl-prolyl cis-t | 0.280 | 0.902 | 0.436 | 1.9e-12 | |
| TIGR_CMR|GSU_0823 | 92 | GSU_0823 "peptidyl-prolyl cis- | 0.273 | 0.880 | 0.376 | 3.1e-12 | |
| UNIPROTKB|Q4KAR2 | 93 | ppiC_1 "Peptidyl-prolyl cis-tr | 0.290 | 0.924 | 0.388 | 1.4e-11 | |
| TIGR_CMR|CPS_0749 | 92 | CPS_0749 "peptidyl-prolyl cis- | 0.273 | 0.880 | 0.380 | 1.4e-11 | |
| TIGR_CMR|SO_0635 | 92 | SO_0635 "peptidyl-prolyl cis-t | 0.273 | 0.880 | 0.392 | 4.4e-11 |
| TAIR|locus:2150235 AT5G19370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 740 (265.6 bits), Expect = 2.8e-73, P = 2.8e-73
Identities = 138/209 (66%), Positives = 172/209 (82%)
Query: 88 REILVQHLLVKEDDLNLLSELQRRVSQGREDLSDLAVEHSICPSKGEGGMLGWVRKGQLV 147
REILVQHLLVK +D+ L +ELQ++ G E++SDLA E+SICPSK +GG+LGWV+ GQ+V
Sbjct: 94 REILVQHLLVKNNDVELFAELQKKFLDG-EEMSDLAAEYSICPSKKDGGILGWVKLGQMV 152
Query: 148 PEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQ 207
PEFEE AF LN+V RC+T+FG HLLQVLSERE ++DIQ +ELH KMQDP F EAQ
Sbjct: 153 PEFEEAAFKAELNQVVRCRTQFGLHLLQVLSEREP--VKDIQVEELHSKMQDPVFMDEAQ 210
Query: 208 LIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWL 267
LIDVREP E+ ++SLPGF+V PLRQFG+W PDIT K +P+KDT+V+C G RS+QVA WL
Sbjct: 211 LIDVREPNEIEIASLPGFKVFPLRQFGTWAPDITSKLNPEKDTFVLCKVGGRSMQVANWL 270
Query: 268 QTQGFRRVFNVSGGIHAYATKVDPSIPTY 296
Q+QGF+ V+N++GGI AY+ KVDPSIPTY
Sbjct: 271 QSQGFKSVYNITGGIQAYSLKVDPSIPTY 299
|
|
| UNIPROTKB|Q607L7 MCA1742 "Rhodanese-like domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3482 CPS_3482 "peptidyl-prolyl cis-trans isomerase C" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3636 CPS_3636 "peptidyl-prolyl cis-trans isomerase C" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A9L5 ppiC "peptidyl-prolyl cis-trans isomerase C (rotamase C)" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1832 SO_1832 "peptidyl-prolyl cis-trans isomerase C" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0823 GSU_0823 "peptidyl-prolyl cis-trans isomerase C" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4KAR2 ppiC_1 "Peptidyl-prolyl cis-trans isomerase C" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0749 CPS_0749 "peptidyl-prolyl cis-trans isomerase C" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_0635 SO_0635 "peptidyl-prolyl cis-trans isomerase C" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| cd01528 | 101 | cd01528, RHOD_2, Member of the Rhodanese Homology | 2e-41 | |
| COG0607 | 110 | COG0607, PspE, Rhodanese-related sulfurtransferase | 4e-21 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 5e-19 | |
| pfam00639 | 94 | pfam00639, Rotamase, PPIC-type PPIASE domain | 1e-18 | |
| cd01526 | 122 | cd01526, RHOD_ThiF, Member of the Rhodanese Homolo | 1e-16 | |
| PRK15441 | 93 | PRK15441, PRK15441, peptidyl-prolyl cis-trans isom | 3e-15 | |
| cd01444 | 96 | cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and | 1e-14 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 1e-13 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 1e-13 | |
| pfam13616 | 114 | pfam13616, Rotamase_3, PPIC-type PPIASE domain | 9e-13 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 1e-12 | |
| COG0760 | 320 | COG0760, SurA, Parvulin-like peptidyl-prolyl isome | 5e-12 | |
| PRK03095 | 287 | PRK03095, prsA, peptidylprolyl isomerase; Reviewed | 1e-11 | |
| cd01524 | 90 | cd01524, RHOD_Pyr_redox, Member of the Rhodanese H | 1e-10 | |
| TIGR02933 | 256 | TIGR02933, nifM_nitrog, nitrogen fixation protein | 2e-10 | |
| PRK02998 | 283 | PRK02998, prsA, peptidylprolyl isomerase; Reviewed | 3e-09 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 5e-09 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 6e-09 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 2e-08 | |
| PRK00162 | 108 | PRK00162, glpE, thiosulfate sulfurtransferase; Val | 9e-08 | |
| cd01447 | 103 | cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe | 2e-07 | |
| cd01518 | 101 | cd01518, RHOD_YceA, Member of the Rhodanese Homolo | 2e-07 | |
| PRK00059 | 336 | PRK00059, prsA, peptidylprolyl isomerase; Provisio | 1e-06 | |
| cd01519 | 106 | cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom | 1e-06 | |
| PRK03002 | 285 | PRK03002, prsA, peptidylprolyl isomerase; Reviewed | 2e-06 | |
| PTZ00356 | 115 | PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isom | 2e-06 | |
| COG1054 | 308 | COG1054, COG1054, Predicted sulfurtransferase [Gen | 1e-05 | |
| PRK00142 | 314 | PRK00142, PRK00142, putative rhodanese-related sul | 6e-05 | |
| cd01522 | 117 | cd01522, RHOD_1, Member of the Rhodanese Homology | 1e-04 | |
| PRK10770 | 413 | PRK10770, PRK10770, peptidyl-prolyl cis-trans isom | 3e-04 | |
| cd01527 | 99 | cd01527, RHOD_YgaP, Member of the Rhodanese Homolo | 4e-04 | |
| TIGR04271 | 101 | TIGR04271, ThiI_C_thiazole, thiazole biosynthesis | 0.002 | |
| PRK01269 | 482 | PRK01269, PRK01269, tRNA s(4)U8 sulfurtransferase; | 0.003 |
| >gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
Score = 138 bits (350), Expect = 2e-41
Identities = 47/104 (45%), Positives = 65/104 (62%), Gaps = 3/104 (2%)
Query: 187 DIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDP 246
I EL + + D +E LIDVREPEE+ ++ LPGF LP+ + ++ +P
Sbjct: 1 QISVAELAEWLADER--EEPVLIDVREPEELEIAFLPGFLHLPMSEIPERSKELD-SDNP 57
Query: 247 QKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVD 290
KD V+CHHG RS+QVAQWL QGF V+N+ GGI A++ +VD
Sbjct: 58 DKDIVVLCHHGGRSMQVAQWLLRQGFENVYNLQGGIDAWSLEVD 101
|
Subgroup 2 includes uncharacterized putative rhodanese-related domains. Length = 101 |
| >gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|216038 pfam00639, Rotamase, PPIC-type PPIASE domain | Back alignment and domain information |
|---|
| >gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|185338 PRK15441, PRK15441, peptidyl-prolyl cis-trans isomerase C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|222266 pfam13616, Rotamase_3, PPIC-type PPIASE domain | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223831 COG0760, SurA, Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|179537 PRK03095, prsA, peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|131979 TIGR02933, nifM_nitrog, nitrogen fixation protein NifM | Back alignment and domain information |
|---|
| >gnl|CDD|179522 PRK02998, prsA, peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238776 cd01518, RHOD_YceA, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|234605 PRK00059, prsA, peptidylprolyl isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|101162 PRK03002, prsA, peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185573 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isomerase (PPIase); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223982 COG1054, COG1054, Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234663 PRK00142, PRK00142, putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236758 PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|211994 TIGR04271, ThiI_C_thiazole, thiazole biosynthesis domain | Back alignment and domain information |
|---|
| >gnl|CDD|234932 PRK01269, PRK01269, tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| PRK10770 | 413 | peptidyl-prolyl cis-trans isomerase SurA; Provisio | 99.93 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.89 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.87 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.87 | |
| PF13616 | 117 | Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3 | 99.87 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.87 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.85 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.85 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.85 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.85 | |
| TIGR02933 | 256 | nifM_nitrog nitrogen fixation protein NifM. Member | 99.84 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.84 | |
| PRK15441 | 93 | peptidyl-prolyl cis-trans isomerase C; Provisional | 99.84 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.83 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.83 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.82 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.82 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.82 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.81 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.81 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.81 | |
| PTZ00356 | 115 | peptidyl-prolyl cis-trans isomerase (PPIase); Prov | 99.8 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.8 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.8 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.8 | |
| PF00639 | 95 | Rotamase: PPIC-type PPIASE domain; InterPro: IPR00 | 99.8 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.8 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.79 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 99.79 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.79 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.79 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.79 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.79 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.79 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.78 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.78 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.77 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.77 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.76 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.76 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.76 | |
| PRK03002 | 285 | prsA peptidylprolyl isomerase; Reviewed | 99.76 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.75 | |
| PRK04405 | 298 | prsA peptidylprolyl isomerase; Provisional | 99.75 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.74 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.74 | |
| KOG3259 | 163 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 99.74 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.73 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.73 | |
| PRK10770 | 413 | peptidyl-prolyl cis-trans isomerase SurA; Provisio | 99.73 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.73 | |
| PRK02998 | 283 | prsA peptidylprolyl isomerase; Reviewed | 99.72 | |
| PRK03095 | 287 | prsA peptidylprolyl isomerase; Reviewed | 99.71 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.71 | |
| KOG3258 | 133 | consensus Parvulin-like peptidyl-prolyl cis-trans | 99.69 | |
| PRK00059 | 336 | prsA peptidylprolyl isomerase; Provisional | 99.67 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.67 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.66 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 99.66 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.66 | |
| PRK12450 | 309 | foldase protein PrsA; Reviewed | 99.63 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.63 | |
| PRK01326 | 310 | prsA foldase protein PrsA; Reviewed | 99.62 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.62 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.61 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.61 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.57 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 99.57 | |
| PRK10788 | 623 | periplasmic folding chaperone; Provisional | 99.57 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.55 | |
| TIGR02925 | 232 | cis_trans_EpsD peptidyl-prolyl cis-trans isomerase | 99.52 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.46 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 99.35 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.34 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 99.28 | |
| COG0760 | 320 | SurA Parvulin-like peptidyl-prolyl isomerase [Post | 99.19 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 99.03 | |
| KOG3259 | 163 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 99.02 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 98.65 | |
| PRK10788 | 623 | periplasmic folding chaperone; Provisional | 98.64 | |
| PF13616 | 117 | Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3 | 98.58 | |
| PTZ00356 | 115 | peptidyl-prolyl cis-trans isomerase (PPIase); Prov | 98.38 | |
| PF00639 | 95 | Rotamase: PPIC-type PPIASE domain; InterPro: IPR00 | 98.37 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 98.31 | |
| TIGR02933 | 256 | nifM_nitrog nitrogen fixation protein NifM. Member | 98.17 | |
| KOG3258 | 133 | consensus Parvulin-like peptidyl-prolyl cis-trans | 98.16 | |
| PF13145 | 121 | Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2 | 98.07 | |
| PRK15441 | 93 | peptidyl-prolyl cis-trans isomerase C; Provisional | 98.04 | |
| PRK04405 | 298 | prsA peptidylprolyl isomerase; Provisional | 97.79 | |
| PRK03095 | 287 | prsA peptidylprolyl isomerase; Reviewed | 97.7 | |
| PRK02998 | 283 | prsA peptidylprolyl isomerase; Reviewed | 97.63 | |
| PRK03002 | 285 | prsA peptidylprolyl isomerase; Reviewed | 97.52 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 96.48 | |
| PRK12450 | 309 | foldase protein PrsA; Reviewed | 96.34 | |
| PRK00059 | 336 | prsA peptidylprolyl isomerase; Provisional | 96.26 | |
| PRK01326 | 310 | prsA foldase protein PrsA; Reviewed | 96.24 | |
| COG0760 | 320 | SurA Parvulin-like peptidyl-prolyl isomerase [Post | 95.39 | |
| TIGR02925 | 232 | cis_trans_EpsD peptidyl-prolyl cis-trans isomerase | 94.48 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 92.16 | |
| KOG1093 | 725 | consensus Predicted protein kinase (contains TBC a | 91.26 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 87.25 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 84.9 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 84.77 |
| >PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional | Back alignment and domain information |
|---|
Probab=99.93 E-value=3.3e-27 Score=220.84 Aligned_cols=177 Identities=17% Similarity=0.222 Sum_probs=150.4
Q ss_pred cccccCCch----hhhhccccccccccccCCccccccCCchhH-HhhhhccCCCCCCCceeeeecccccCchhhcccccC
Q 022496 3 LRASQLASP----VLCAITQSLIPTLNLSSSSSLSIFQKPASF-ASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSG 77 (296)
Q Consensus 3 ~~~~~~~~~----~~~~~~~~~~~~~~~~r~~~~~~~~~f~~l-~~~s~~~~~~~~~~~l~~~~~~~~~~~~e~~~~~~~ 77 (296)
++.+||+-+ .+.+.+.......+.++..+..|. .|+.+ +.||+++. +.+||++||+..+.+.++|+.+.|.++
T Consensus 156 ~~~~~I~i~~~~~~s~~~~~~~~~~a~~l~~~l~~g~-~F~~lA~~yS~~~~-a~~gGdlg~~~~~~l~~~~~~~~~~l~ 233 (413)
T PRK10770 156 LNLSHILIPLPENPTQDQVDEAESQARSIVDQARNGA-DFGKLAIAYSADQQ-ALKGGQMGWGRIQELPGLFAQALSTAK 233 (413)
T ss_pred EEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHhCCCcc-cccCCcCCccccccccHHHHHHHHhCC
Confidence 355677643 234445555566677777777774 89999 99999985 889999999999999999999999999
Q ss_pred CCCCCCC--------------CC-------CceEEEeeEeeccc-------hHHHHHHHHHHHhcCC-ccHHHHHHhhCC
Q 022496 78 TEGSSPG--------------GG-------DREILVQHLLVKED-------DLNLLSELQRRVSQGR-EDLSDLAVEHSI 128 (296)
Q Consensus 78 ~~~i~~~--------------~~-------~~~~~~~~Il~~~~-------~~~~a~~i~~~l~~~g-~~F~~la~~~S~ 128 (296)
+|+|+.| .. ..+++++||++++. +++++++|+++|. +| .+|+++|++||+
T Consensus 234 ~G~is~Pi~t~~GyhIikl~~~~~~~~~~~~~e~~~~hIli~~~~~~~~~~a~~~~~~i~~~i~-~g~~~F~~~A~~~S~ 312 (413)
T PRK10770 234 KGDIVGPIRSGVGFHILKVNDLRGESQNISVTEVHARHILLKPSPIMTDEQARAKLEQIAADIK-SGKTTFAAAAKEFSQ 312 (413)
T ss_pred CCCCCCcEECCCceEEEEEeeeccccccchHHhhhhhheEECCCCCCCHHHHHHHHHHHHHHHH-cCcccHHHHHHHhCC
Confidence 9999988 11 23689999999853 5678999999996 67 599999999999
Q ss_pred CC-cccCCcccccccCCCCcHHHHHHHhcCCCCcee-ceeecCcceEEEeehhhhh
Q 022496 129 CP-SKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVA-RCKTKFGWHLLQVLSEREA 182 (296)
Q Consensus 129 d~-~~~~gG~lg~~~~~~l~~~~~~~~~~l~~G~vs-pv~~~~G~~Ii~v~~~~~~ 182 (296)
|+ ++.+||+|||+..+.++|+|..++++|++|++| |+.|++|||||++++.+..
T Consensus 313 d~~s~~~gG~lg~~~~~~~~~~~~~~~~~l~~GeiS~pv~t~~g~~ii~v~~~~~~ 368 (413)
T PRK10770 313 DPGSANQGGDLGWATPDIFDPAFRDALMRLNKGQISAPVHSSFGWHLIELLDTRQV 368 (413)
T ss_pred CCChHhhCCcCCccCccccCHHHHHHHHcCCCCCcCCcEEcCCeEEEEEEeecccC
Confidence 97 889999999999999999999999999999999 8999999999999987654
|
|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF13616 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02933 nifM_nitrog nitrogen fixation protein NifM | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PTZ00356 peptidyl-prolyl cis-trans isomerase (PPIase); Provisional | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00639 Rotamase: PPIC-type PPIASE domain; InterPro: IPR000297 Peptidylprolyl isomerase (5 | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK03002 prsA peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >PRK04405 prsA peptidylprolyl isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK02998 prsA peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >PRK03095 prsA peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >KOG3258 consensus Parvulin-like peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00059 prsA peptidylprolyl isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12450 foldase protein PrsA; Reviewed | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK01326 prsA foldase protein PrsA; Reviewed | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10788 periplasmic folding chaperone; Provisional | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10788 periplasmic folding chaperone; Provisional | Back alignment and domain information |
|---|
| >PF13616 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A | Back alignment and domain information |
|---|
| >PTZ00356 peptidyl-prolyl cis-trans isomerase (PPIase); Provisional | Back alignment and domain information |
|---|
| >PF00639 Rotamase: PPIC-type PPIASE domain; InterPro: IPR000297 Peptidylprolyl isomerase (5 | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02933 nifM_nitrog nitrogen fixation protein NifM | Back alignment and domain information |
|---|
| >KOG3258 consensus Parvulin-like peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13145 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2KGJ_A | Back alignment and domain information |
|---|
| >PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional | Back alignment and domain information |
|---|
| >PRK04405 prsA peptidylprolyl isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK03095 prsA peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >PRK02998 prsA peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >PRK03002 prsA peptidylprolyl isomerase; Reviewed | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12450 foldase protein PrsA; Reviewed | Back alignment and domain information |
|---|
| >PRK00059 prsA peptidylprolyl isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK01326 prsA foldase protein PrsA; Reviewed | Back alignment and domain information |
|---|
| >COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 296 | ||||
| 1jns_A | 92 | Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRA | 1e-12 | ||
| 3iwh_A | 103 | Crystal Structure Of Rhodanese-Like Domain Protein | 2e-09 | ||
| 3foj_A | 100 | Crystal Structure Of Ssp1007 From Staphylococcus Sa | 5e-08 | ||
| 1yw5_A | 177 | Peptidyl-Prolyl Isomerase Ess1 From Candida Albican | 3e-07 | ||
| 1gn0_A | 108 | Escherichia Coli Glpe Sulfurtransferase Soaked With | 4e-06 | ||
| 1zk6_A | 93 | Nmr Solution Structure Of B. Subtilis Prsa Ppiase L | 1e-05 | ||
| 3icr_A | 588 | Crystal Structure Of Oxidized Bacillus Anthracis Co | 1e-05 | ||
| 3rfw_A | 252 | The Virulence Factor Peb4 And The Periplasmic Prote | 4e-05 | ||
| 1m5y_A | 408 | Crystallographic Structure Of Sura, A Molecular Cha | 5e-05 | ||
| 3ui4_A | 101 | 0.8 A Resolution Crystal Structure Of Human Parvuli | 5e-05 | ||
| 1fjd_A | 104 | Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMER | 5e-05 | ||
| 1qxn_A | 137 | Solution Structure Of The 30 Kda Polysulfide-Sulfur | 5e-05 | ||
| 1gmx_A | 108 | Escherichia Coli Glpe Sulfurtransferase Length = 10 | 1e-04 | ||
| 1eq3_A | 96 | Nmr Structure Of Human Parvulin Hpar14 Length = 96 | 3e-04 | ||
| 4g2p_A | 110 | Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom | 6e-04 |
| >pdb|1JNS|A Chain A, Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRANS- Isomerase Parvulin 10 Length = 92 | Back alignment and structure |
|
| >pdb|3IWH|A Chain A, Crystal Structure Of Rhodanese-Like Domain Protein From Staphylococcus Aureus Length = 103 | Back alignment and structure |
| >pdb|3FOJ|A Chain A, Crystal Structure Of Ssp1007 From Staphylococcus Saprophyticus Subsp. Saprophyticus. Northeast Structural Genomics Target Syr101a Length = 100 | Back alignment and structure |
| >pdb|1YW5|A Chain A, Peptidyl-Prolyl Isomerase Ess1 From Candida Albicans Length = 177 | Back alignment and structure |
| >pdb|1GN0|A Chain A, Escherichia Coli Glpe Sulfurtransferase Soaked With Kcn Length = 108 | Back alignment and structure |
| >pdb|1ZK6|A Chain A, Nmr Solution Structure Of B. Subtilis Prsa Ppiase Length = 93 | Back alignment and structure |
| >pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 | Back alignment and structure |
| >pdb|3RFW|A Chain A, The Virulence Factor Peb4 And The Periplasmic Protein Cj1289 Are Two Structurally-Related Sura-Like Chaperones In The Human Pathogen Campylobacter Jejuni Length = 252 | Back alignment and structure |
| >pdb|1M5Y|A Chain A, Crystallographic Structure Of Sura, A Molecular Chaperone That Facilitates Outer Membrane Porin Folding Length = 408 | Back alignment and structure |
| >pdb|3UI4|A Chain A, 0.8 A Resolution Crystal Structure Of Human Parvulin 14 Length = 101 | Back alignment and structure |
| >pdb|1FJD|A Chain A, Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMERASE, Hpar14 Length = 104 | Back alignment and structure |
| >pdb|1QXN|A Chain A, Solution Structure Of The 30 Kda Polysulfide-Sulfur Transferase Homodimer From Wolinella Succinogenes Length = 137 | Back alignment and structure |
| >pdb|1GMX|A Chain A, Escherichia Coli Glpe Sulfurtransferase Length = 108 | Back alignment and structure |
| >pdb|1EQ3|A Chain A, Nmr Structure Of Human Parvulin Hpar14 Length = 96 | Back alignment and structure |
| >pdb|4G2P|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Domain Ii Of Molecular Chaperone Sura From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. 14028s Length = 110 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 2e-37 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 6e-33 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 2e-32 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 5e-31 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 7e-30 | |
| 1jns_A | 92 | Peptidyl-prolyl CIS-trans isomerase C; alpha-beta | 9e-27 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 1e-26 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 5e-26 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 9e-26 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 1e-25 | |
| 4g2p_A | 110 | Chaperone SURA; structural genomics, PSI-biology, | 9e-25 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 1e-24 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 5e-24 | |
| 1zk6_A | 93 | Foldase protein PRSA; alpha/beta structure, isomer | 2e-23 | |
| 3ui4_A | 101 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 3e-23 | |
| 2rqs_A | 97 | Parvulin-like peptidyl-prolyl isomerase; CIS/trans | 9e-23 | |
| 3tc5_A | 166 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 2e-22 | |
| 3i6c_A | 123 | Peptidyl-prolyl CIS-trans isomerase NIMA- interact | 2e-22 | |
| 3gpk_A | 112 | PPIC-type peptidyl-prolyl CIS-trans isomerase; rot | 2e-22 | |
| 1j6y_A | 139 | Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN | 4e-22 | |
| 1yw5_A | 177 | Peptidyl prolyl CIS/trans isomerase; WW-domain, pp | 2e-21 | |
| 2jzv_A | 111 | Foldase protein PRSA; ppiase, parvulin, proline is | 8e-21 | |
| 3rfw_A | 252 | Cell-binding factor 2; SURA-like, chaperone; 2.20A | 1e-20 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 9e-20 | |
| 2pv1_A | 103 | Chaperone SURA; surviVal protein A, peptidyl-proly | 1e-19 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 2e-19 | |
| 2kgj_A | 102 | Peptidyl-prolyl CIS-trans isomerase D; prolyl isom | 3e-19 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 5e-18 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 8e-18 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 9e-18 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 1e-17 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 6e-17 | |
| 1m5y_A | 408 | SurviVal protein, surviVal protein SURA; surviVal | 3e-16 | |
| 1m5y_A | 408 | SurviVal protein, surviVal protein SURA; surviVal | 7e-12 | |
| 3nrk_A | 325 | LIC12922; NC domain, parvulin domain, SURA homolog | 4e-16 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 6e-15 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 6e-14 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-11 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 5e-11 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 5e-14 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 3e-13 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 4e-13 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 5e-13 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 4e-10 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 3e-09 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 4e-09 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 6e-07 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 4e-06 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 6e-06 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 3e-05 | |
| 3rgc_A | 252 | Possible periplasmic protein; ppiase, chaperone; 2 | 1e-04 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 4e-04 |
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
Score = 128 bits (323), Expect = 2e-37
Identities = 28/128 (21%), Positives = 47/128 (36%), Gaps = 22/128 (17%)
Query: 188 IQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQF-------------G 234
+ + + + L+DVR EV + LP +PL+
Sbjct: 3 VSVTDYKRLLDS---GAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEA 59
Query: 235 SWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRR------VFNVSGGIHAYATK 288
W + YV+C G S + + LQ+ + V +V GG+ A+A K
Sbjct: 60 IWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAK 119
Query: 289 VDPSIPTY 296
+D + P Y
Sbjct: 120 IDGTFPQY 127
|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 | Back alignment and structure |
|---|
| >1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Length = 92 | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Length = 110 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Length = 93 | Back alignment and structure |
|---|
| >3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} PDB: 3ui5_A 1fjd_A 1eq3_A Length = 101 | Back alignment and structure |
|---|
| >2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Length = 97 | Back alignment and structure |
|---|
| >3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166 | Back alignment and structure |
|---|
| >3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Length = 123 | Back alignment and structure |
|---|
| >3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Length = 112 | Back alignment and structure |
|---|
| >1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Length = 139 | Back alignment and structure |
|---|
| >1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177 | Back alignment and structure |
|---|
| >2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Length = 111 | Back alignment and structure |
|---|
| >3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Length = 252 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 | Back alignment and structure |
|---|
| >2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Length = 103 | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 | Back alignment and structure |
|---|
| >2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Length = 102 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 | Back alignment and structure |
|---|
| >1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 | Back alignment and structure |
|---|
| >1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 | Back alignment and structure |
|---|
| >3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Length = 325 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 | Back alignment and structure |
|---|
| >3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Length = 252 | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Length = 265 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.92 | |
| 4g2p_A | 110 | Chaperone SURA; structural genomics, PSI-biology, | 99.92 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.91 | |
| 2lj4_A | 115 | Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; | 99.91 | |
| 3gpk_A | 112 | PPIC-type peptidyl-prolyl CIS-trans isomerase; rot | 99.91 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.91 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.91 | |
| 1m5y_A | 408 | SurviVal protein, surviVal protein SURA; surviVal | 99.9 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.9 | |
| 3i6c_A | 123 | Peptidyl-prolyl CIS-trans isomerase NIMA- interact | 99.9 | |
| 1jns_A | 92 | Peptidyl-prolyl CIS-trans isomerase C; alpha-beta | 99.9 | |
| 2pv1_A | 103 | Chaperone SURA; surviVal protein A, peptidyl-proly | 99.89 | |
| 3ui4_A | 101 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 99.89 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.89 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.89 | |
| 1zk6_A | 93 | Foldase protein PRSA; alpha/beta structure, isomer | 99.88 | |
| 3tc5_A | 166 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 99.88 | |
| 2kgj_A | 102 | Peptidyl-prolyl CIS-trans isomerase D; prolyl isom | 99.88 | |
| 2rqs_A | 97 | Parvulin-like peptidyl-prolyl isomerase; CIS/trans | 99.88 | |
| 2jzv_A | 111 | Foldase protein PRSA; ppiase, parvulin, proline is | 99.88 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.88 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.88 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.87 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.87 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.87 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.87 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.86 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.86 | |
| 1j6y_A | 139 | Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN | 99.85 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.84 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.84 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.83 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.83 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.83 | |
| 1yw5_A | 177 | Peptidyl prolyl CIS/trans isomerase; WW-domain, pp | 99.83 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.83 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.8 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.79 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.79 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.78 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.78 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.78 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.77 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.77 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.77 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.76 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.76 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.76 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.76 | |
| 3rfw_A | 252 | Cell-binding factor 2; SURA-like, chaperone; 2.20A | 99.75 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.75 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.75 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.75 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.74 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.74 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.74 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.74 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.74 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.73 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.73 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.72 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.72 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.72 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.71 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.71 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.71 | |
| 3nrk_A | 325 | LIC12922; NC domain, parvulin domain, SURA homolog | 99.7 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.69 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.68 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.68 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.68 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.68 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.67 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.66 | |
| 1m5y_A | 408 | SurviVal protein, surviVal protein SURA; surviVal | 99.65 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.65 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.62 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.6 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.6 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.45 | |
| 3rgc_A | 252 | Possible periplasmic protein; ppiase, chaperone; 2 | 99.38 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.31 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.25 | |
| 2lj4_A | 115 | Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; | 99.17 | |
| 4g2p_A | 110 | Chaperone SURA; structural genomics, PSI-biology, | 98.96 | |
| 3i6c_A | 123 | Peptidyl-prolyl CIS-trans isomerase NIMA- interact | 98.89 | |
| 3gpk_A | 112 | PPIC-type peptidyl-prolyl CIS-trans isomerase; rot | 98.86 | |
| 3tc5_A | 166 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 98.81 | |
| 1j6y_A | 139 | Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN | 98.67 | |
| 2pv1_A | 103 | Chaperone SURA; surviVal protein A, peptidyl-proly | 98.63 | |
| 2jzv_A | 111 | Foldase protein PRSA; ppiase, parvulin, proline is | 98.62 | |
| 1yw5_A | 177 | Peptidyl prolyl CIS/trans isomerase; WW-domain, pp | 98.59 | |
| 1zk6_A | 93 | Foldase protein PRSA; alpha/beta structure, isomer | 98.57 | |
| 2kgj_A | 102 | Peptidyl-prolyl CIS-trans isomerase D; prolyl isom | 98.56 | |
| 2rqs_A | 97 | Parvulin-like peptidyl-prolyl isomerase; CIS/trans | 98.55 | |
| 1jns_A | 92 | Peptidyl-prolyl CIS-trans isomerase C; alpha-beta | 98.5 | |
| 3ui4_A | 101 | Peptidyl-prolyl CIS-trans isomerase NIMA-interact; | 98.38 | |
| 3nrk_A | 325 | LIC12922; NC domain, parvulin domain, SURA homolog | 97.64 | |
| 3rfw_A | 252 | Cell-binding factor 2; SURA-like, chaperone; 2.20A | 97.59 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 97.18 | |
| 3rgc_A | 252 | Possible periplasmic protein; ppiase, chaperone; 2 | 89.97 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 86.3 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 83.47 |
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
Probab=99.92 E-value=2e-25 Score=167.57 Aligned_cols=98 Identities=32% Similarity=0.592 Sum_probs=86.4
Q ss_pred cCCCHHHHHHHhcCCCCCCCcEEEecCChHHHHhhCCCCceecccccccCCCCCccCCCCCCCcEEEEeCCChhHHHHHH
Q 022496 186 QDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQ 265 (296)
Q Consensus 186 ~~is~~ev~~~L~~~~~~~~~~llDvR~~~ey~~ghIpgA~~ip~~~l~~~~~~~~~~~~~~~~iv~~C~~G~rs~~aa~ 265 (296)
+.++++++++++.++ ++..+||||++.||..||||||+|||+.+|.... ..++++++||+||.+|.||..++.
T Consensus 2 k~Is~~el~~~l~~~---~~~~liDvR~~~e~~~ghIpgA~~ip~~~l~~~~----~~l~~~~~ivv~C~~G~rS~~aa~ 74 (103)
T 3iwh_A 2 KSITTDELKNKLLES---KPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNL----NSFNKNEIYYIVCAGGVRSAKVVE 74 (103)
T ss_dssp CEECHHHHHHGGGSS---SCCEEEECSCHHHHTTCBCTTCEECCGGGGGGCG----GGCCTTSEEEEECSSSSHHHHHHH
T ss_pred CCcCHHHHHHHHhCC---CCeEEEECCChhHHhcCccCCcccCcccchhhhh----hhhcCCCeEEEECCCCHHHHHHHH
Confidence 458899999988775 5789999999999999999999999999987653 456899999999999999999999
Q ss_pred HHHHcCCCceEEccchHHHhhhccCC
Q 022496 266 WLQTQGFRRVFNVSGGIHAYATKVDP 291 (296)
Q Consensus 266 ~L~~~G~~~v~~l~GG~~~W~~~~~~ 291 (296)
.|+++||+++ +|.||+.+|..+..|
T Consensus 75 ~L~~~G~~~~-~l~GG~~~W~~~g~p 99 (103)
T 3iwh_A 75 YLEANGIDAV-NVEGGMHAWGDEGLE 99 (103)
T ss_dssp HHHTTTCEEE-EETTHHHHHCSSSCB
T ss_pred HHHHcCCCEE-EecChHHHHHHCCCc
Confidence 9999999654 799999999976544
|
| >4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >2lj4_A Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; tbpin1; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A | Back alignment and structure |
|---|
| >1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A | Back alignment and structure |
|---|
| >2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A | Back alignment and structure |
|---|
| >3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} SCOP: d.26.1.1 PDB: 3ui5_A 3ui6_A 1fjd_A 1eq3_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... | Back alignment and structure |
|---|
| >2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} | Back alignment and structure |
|---|
| >2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2lj4_A Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; tbpin1; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A | Back alignment and structure |
|---|
| >3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... | Back alignment and structure |
|---|
| >1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A | Back alignment and structure |
|---|
| >2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} | Back alignment and structure |
|---|
| >1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} | Back alignment and structure |
|---|
| >1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A | Back alignment and structure |
|---|
| >3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} SCOP: d.26.1.1 PDB: 3ui5_A 3ui6_A 1fjd_A 1eq3_A | Back alignment and structure |
|---|
| >3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} | Back alignment and structure |
|---|
| >3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 296 | ||||
| d1gmxa_ | 108 | c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia | 7e-20 | |
| d1qxna_ | 137 | c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf | 4e-15 | |
| d1j6ya_ | 120 | d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Tha | 1e-13 | |
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 1e-12 | |
| d1eq3a_ | 96 | d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar | 7e-12 | |
| d1m5ya3 | 108 | d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase | 8e-12 | |
| d1pina2 | 119 | d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain | 3e-11 | |
| d1jnsa_ | 92 | d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichi | 4e-11 | |
| d1yt8a3 | 157 | c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase | 1e-10 | |
| d1yt8a2 | 101 | c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P | 3e-10 | |
| d1yt8a1 | 136 | c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase | 4e-10 | |
| d1yt8a4 | 130 | c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase | 9e-10 | |
| d1c25a_ | 161 | c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: | 4e-09 | |
| d1ymka1 | 174 | c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) | 3e-08 | |
| d1e0ca2 | 136 | c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte | 1e-07 | |
| d1e0ca1 | 135 | c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter | 1e-06 | |
| d1t3ka_ | 132 | c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { | 3e-06 | |
| d1rhsa2 | 144 | c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ | 4e-06 | |
| d2pv2a1 | 103 | d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase | 5e-06 | |
| d1urha2 | 120 | c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran | 2e-05 | |
| d2gwfa1 | 135 | c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h | 4e-05 | |
| d1uara1 | 143 | c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther | 0.001 | |
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 0.004 |
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Sulfurtransferase GlpE species: Escherichia coli [TaxId: 562]
Score = 80.5 bits (198), Expect = 7e-20
Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 8/109 (7%)
Query: 185 LQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKF 244
+ I + H+K+Q+ A L+D+R+P+ A+ L
Sbjct: 4 FECINVADAHQKLQEKE----AVLVDIRDPQSFAMGHAVQAFHLTND----TLGAFMRDN 55
Query: 245 DPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSI 293
D VMC+HG S AQ+L QG+ V+++ GG A+ + +
Sbjct: 56 DFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQFPAEV 104
|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 | Back information, alignment and structure |
|---|
| >d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
| >d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Length = 92 | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 | Back information, alignment and structure |
|---|
| >d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 103 | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| d1jnsa_ | 92 | Parvulin 10 (rotamase C) {Escherichia coli [TaxId: | 99.9 | |
| d1pina2 | 119 | Mitotic rotamase PIN1, domain 2 {Human (Homo sapie | 99.9 | |
| d1eq3a_ | 96 | Parvulin {Human (Homo sapiens), hpar14 [TaxId: 960 | 99.89 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.89 | |
| d1m5ya3 | 108 | Porin chaperone SurA, PPIase domains {Escherichia | 99.89 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.88 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.88 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.88 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.88 | |
| d2pv2a1 | 103 | Porin chaperone SurA, PPIase domains {Escherichia | 99.87 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.87 | |
| d1j6ya_ | 120 | Mitotic rotamase PIN1, domain 2 {Thale cress (Arab | 99.87 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.86 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.86 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.84 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.83 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.81 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.8 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.8 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.79 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.79 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.77 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.64 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.57 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.48 | |
| d1pina2 | 119 | Mitotic rotamase PIN1, domain 2 {Human (Homo sapie | 98.92 | |
| d1j6ya_ | 120 | Mitotic rotamase PIN1, domain 2 {Thale cress (Arab | 98.88 | |
| d1m5ya3 | 108 | Porin chaperone SurA, PPIase domains {Escherichia | 98.78 | |
| d1eq3a_ | 96 | Parvulin {Human (Homo sapiens), hpar14 [TaxId: 960 | 98.51 | |
| d1jnsa_ | 92 | Parvulin 10 (rotamase C) {Escherichia coli [TaxId: | 98.47 | |
| d2pv2a1 | 103 | Porin chaperone SurA, PPIase domains {Escherichia | 98.32 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 89.68 | |
| d1jl3a_ | 137 | Arsenate reductase ArsC {Bacillus subtilis [TaxId: | 86.13 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 84.35 |
| >d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: Parvulin 10 (rotamase C) species: Escherichia coli [TaxId: 562]
Probab=99.90 E-value=1.4e-24 Score=157.50 Aligned_cols=89 Identities=39% Similarity=0.729 Sum_probs=83.0
Q ss_pred ceEEEeeEeeccchHHHHHHHHHHHhcCCccHHHHHHhhCCCCcccCCcccccccCCCCcHHHHHHHhcCCCCcee-cee
Q 022496 88 REILVQHLLVKEDDLNLLSELQRRVSQGREDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVA-RCK 166 (296)
Q Consensus 88 ~~~~~~~Il~~~~~~~~a~~i~~~l~~~g~~F~~la~~~S~d~~~~~gG~lg~~~~~~l~~~~~~~~~~l~~G~vs-pv~ 166 (296)
.++.++|||++.+ ++|++++++|+ +|++|+++|++||+|+++.+||+|||++.++++|+|.++++.|++|++| ||+
T Consensus 2 ~~~~a~HIlv~~~--~~A~~i~~~l~-~g~~F~~lA~~~S~d~s~~~gG~lG~~~~~~l~~~f~~~~~~l~~G~vs~pi~ 78 (92)
T d1jnsa_ 2 KTAAALHILVKEE--KLALDLLEQIK-NGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLH 78 (92)
T ss_dssp CEEEEEEEEESSH--HHHHHHHHHHH-HTCCHHHHHHHHHCSTTTTTGGGCCEEETTSSCHHHHHHHHHSCTTCCEEEEE
T ss_pred CcceEEEEEeCCH--HHHHHHHHHHH-CCCCHHHHHHHhCCCcccchhhhhceeeHhhhhhHHHHHHHhCCCCCcCCCEE
Confidence 4689999999854 55999999996 8999999999999999888999999999999999999999999999999 899
Q ss_pred ecCcceEEEeehh
Q 022496 167 TKFGWHLLQVLSE 179 (296)
Q Consensus 167 ~~~G~~Ii~v~~~ 179 (296)
|++|||||++.++
T Consensus 79 t~~G~HIikv~dr 91 (92)
T d1jnsa_ 79 TQFGYHIIKVLYR 91 (92)
T ss_dssp ETTEEEEEEEECC
T ss_pred eCCeEEEEEEEeC
Confidence 9999999999875
|
| >d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|