Citrus Sinensis ID: 022539


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHRAGGAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
cccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEcHHHHccccEEEEEEEEEECcccccCEEEEEEEEEECccccccccEEEcccccccccccccccEEEEEEEccccccEECcccEEEEEEccHHHHccccEEEEEcccccEEEEccccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHccccc
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGT***HHP*******************************TQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITF**********PPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHRAGGAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily B member 1 Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.probableQ3MI00
DnaJ homolog subfamily B member 4 Probable chaperone.probableQ9UDY4
DnaJ homolog subfamily B member 4 Probable chaperone.probableQ5R8J8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AGX, chain A
Confidence level:very confident
Coverage over the Query: 118-292
View the alignment between query and template
View the model in PyMOL
Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 116-291
View the alignment between query and template
View the model in PyMOL