Citrus Sinensis ID: 022539


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHRAGGAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
cccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcHHHHccccEEEEEEEEEEEcccccEEEEEEEEEEEEccccccccEEEcccccccccccccccEEEEEEEccccccEEEcccEEEEEEccHHHHccccEEEEEcccccEEEEccccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHccccc
ccccHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHcccccccccccccccccccccccccccccccccccccccccccccEEcEEEEHHHHHcccEEEEEEEEEccccccccEEEEEEEEEEcccccccccEEEEccccccccccccccEEEEEEEcccccEEEccccEEEEEEEcHHHHHcccEEEEEcccccEEEEEccccccccEEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHcccccc
MGVDYYNILkvsrgateDDLKKSYKRLAMkwhpdknpatnQQAEAKFKLISEAYDvlsdprkrqiydlygpeglkasdfgtpsyhhphdtkpcatrnnnnnnhraggagpkptptpieTQLLCTLEELYKGARKKMKisrvlpdhfgkpitvQEILKIdikpgwkkgtkitfpekgnqepglppadlifvveekphavfqrdgndlVVNHKISLLEALTGlslnltaldgrnltlpvtdiiqpgsevvipnegmpiskdpskkgnliikfdimfpsrltAEQKSDLKRALGGVYV
MGVDYYNIlkvsrgateddLKKSYKRLAMkwhpdknpatnQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHraggagpkptptPIETQLLCTLEELYKGARKKMKisrvlpdhfgkpitvqeilkidikpgwkKGTKITfpekgnqepglPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIiqpgsevvipnegmpiskdpskkGNLIIKFDIMfpsrltaeqksdlkralggvyv
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRnnnnnnHRaggagpkptptpIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
****YYNILKV***********************************FKLISEAYDVLSDPRKRQIYDLYG************************************************TQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITF***********PADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVI***************NLIIKFDIMFPS*******************
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGT***HHP**********************************LCTLEELYKGARKKMK****************EILKIDIKPGWKKGTKITF**********PPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHRAGGAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
**VDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHRA*******TPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFGTPSYHHPHDTKPCATRNNNNNNHRAGGAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGGVYV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q9D832337 DnaJ homolog subfamily B yes no 0.972 0.851 0.409 6e-61
Q3MI00340 DnaJ homolog subfamily B yes no 0.969 0.841 0.400 1e-60
Q9QYJ3340 DnaJ homolog subfamily B no no 0.955 0.829 0.390 1e-59
Q5R8J8337 DnaJ homolog subfamily B yes no 0.972 0.851 0.388 5e-59
Q9UDY4337 DnaJ homolog subfamily B yes no 0.972 0.851 0.388 6e-59
O89114348 DnaJ homolog subfamily B no no 0.976 0.827 0.389 1e-58
O75953348 DnaJ homolog subfamily B no no 0.976 0.827 0.389 1e-58
P25685340 DnaJ homolog subfamily B no no 0.959 0.832 0.385 4e-58
Q2KIT4337 DnaJ homolog subfamily B no no 0.972 0.851 0.376 3e-57
P59910316 DnaJ homolog subfamily B no no 0.972 0.908 0.403 3e-56
>sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=2 SV=1 Back     alignment and function desciption
 Score =  234 bits (596), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 138/337 (40%), Positives = 198/337 (58%), Gaps = 50/337 (14%)

Query: 1   MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDP 60
           MG DYY+IL + +GAT++D+KK+Y++ A+K+HPDKN +   QAE KFK ++EAY+VLSDP
Sbjct: 1   MGKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKSP--QAEEKFKEVAEAYEVLSDP 58

Query: 61  RKRQIYDLYGPEGLKASD---------FGTPSYHHPHDTKPCATRNNN----NNNHRAGG 107
           +KR+IYD +G EGLK            F    +  PH T       +N        R GG
Sbjct: 59  KKREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGG 118

Query: 108 A------------------------------GP---KPTPTPIETQLLCTLEELYKGARK 134
                                          GP   K  P PI  +L  +LEE+Y G  K
Sbjct: 119 GRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDP-PIIHELKVSLEEIYSGCTK 177

Query: 135 KMKISRVLPDHFGKPITVQE-ILKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEE 193
           +MKISR   +  G+    ++ IL I+IK GWK+GTKITFP +G++ P   PAD++FV+++
Sbjct: 178 RMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFVIKD 237

Query: 194 KPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEG 253
           K H  F+RDG+++V   KISL EAL G SLN+  +DGRNL + VTDI++PG    +   G
Sbjct: 238 KEHPKFKRDGSNIVYTAKISLREALCGCSLNVPTMDGRNLPMSVTDIVKPGMRRRVIGYG 297

Query: 254 MPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRAL 290
           +P  K+P ++G+L+I+FD+ FP  ++A  K  L++ L
Sbjct: 298 LPFPKNPDQRGDLLIEFDVSFPDVISAASKEILRKHL 334




Probable chaperone.
Mus musculus (taxid: 10090)
>sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 Back     alignment and function description
>sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=2 SV=3 Back     alignment and function description
>sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 Back     alignment and function description
>sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 Back     alignment and function description
>sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 Back     alignment and function description
>sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 Back     alignment and function description
>sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 Back     alignment and function description
>sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
224100435317 predicted protein [Populus trichocarpa] 0.979 0.911 0.656 1e-114
118486073317 unknown [Populus trichocarpa] 0.979 0.911 0.656 1e-114
224100239314 predicted protein [Populus trichocarpa] 0.983 0.923 0.662 1e-113
255558264321 Curved DNA-binding protein, putative [Ri 0.989 0.909 0.653 1e-112
297849360342 hypothetical protein ARALYDRAFT_471147 [ 0.986 0.850 0.587 1e-110
449434843316 PREDICTED: dnaJ homolog subfamily B memb 0.983 0.917 0.657 1e-109
449478479322 PREDICTED: dnaJ homolog subfamily B memb 0.983 0.900 0.644 1e-108
15218515349 putative DNAJ heat-shock protein [Arabid 0.986 0.833 0.573 1e-108
297840613334 predicted protein [Arabidopsis lyrata su 0.989 0.874 0.600 1e-105
15218901331 putative DNAJ heat shock protein [Arabid 0.989 0.882 0.6 1e-105
>gi|224100435|ref|XP_002311874.1| predicted protein [Populus trichocarpa] gi|222851694|gb|EEE89241.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/317 (65%), Positives = 245/317 (77%), Gaps = 28/317 (8%)

Query: 1   MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDP 60
           MGVDYYNILK++R ATE+D+KK+YKRLAMKWHPDKNP   ++AEAKFKLISEAYDVLSDP
Sbjct: 1   MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDKNPVNKKEAEAKFKLISEAYDVLSDP 60

Query: 61  RKRQIYDLYGPEGLKASD--------FGTPSYHHPHDTKPCAT----------------- 95
            KRQIYDLYG EGLK+ D         G     +P D +                     
Sbjct: 61  NKRQIYDLYGEEGLKSFDQIPPPTTNVGASFRFNPRDAEDIFAEFFGGGGGSGGVGKGYF 120

Query: 96  RNNNNNNHRAGGAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEI 155
           RNNN NN+   GA       P+E++LLCTLEELYKG R+KM+ISR +PD FGKP TV+EI
Sbjct: 121 RNNNGNNY---GAELNRKAAPVESKLLCTLEELYKGTRRKMRISRSVPDDFGKPKTVEEI 177

Query: 156 LKIDIKPGWKKGTKITFPEKGNQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLL 215
           LKIDIKPGWKKGTKITFPEKGNQEPG+ PADLIFVV+EKPH+VF+RDGNDLV+N KISLL
Sbjct: 178 LKIDIKPGWKKGTKITFPEKGNQEPGITPADLIFVVDEKPHSVFKRDGNDLVINQKISLL 237

Query: 216 EALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFP 275
           EALTG ++ LT LDGR L +PVTDI++PG E+++ NEGMPISK+P+K+GNL IKFD+ FP
Sbjct: 238 EALTGKTIELTTLDGRYLPVPVTDIVKPGQELLVSNEGMPISKEPTKRGNLRIKFDVTFP 297

Query: 276 SRLTAEQKSDLKRALGG 292
           +RLT EQKSDLK+ALG 
Sbjct: 298 TRLTVEQKSDLKKALGA 314




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118486073|gb|ABK94880.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224100239|ref|XP_002311798.1| predicted protein [Populus trichocarpa] gi|222851618|gb|EEE89165.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558264|ref|XP_002520159.1| Curved DNA-binding protein, putative [Ricinus communis] gi|223540651|gb|EEF42214.1| Curved DNA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297849360|ref|XP_002892561.1| hypothetical protein ARALYDRAFT_471147 [Arabidopsis lyrata subsp. lyrata] gi|297338403|gb|EFH68820.1| hypothetical protein ARALYDRAFT_471147 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449434843|ref|XP_004135205.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449478479|ref|XP_004155329.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15218515|ref|NP_172506.1| putative DNAJ heat-shock protein [Arabidopsis thaliana] gi|4914337|gb|AAD32885.1|AC005489_23 F14N23.23 [Arabidopsis thaliana] gi|13430680|gb|AAK25962.1|AF360252_1 putative heat-shock protein [Arabidopsis thaliana] gi|14532888|gb|AAK64126.1| putative heat-shock protein [Arabidopsis thaliana] gi|332190448|gb|AEE28569.1| putative DNAJ heat-shock protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297840613|ref|XP_002888188.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334029|gb|EFH64447.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15218901|ref|NP_176181.1| putative DNAJ heat shock protein [Arabidopsis thaliana] gi|5080806|gb|AAD39315.1|AC007258_4 Putative heat shock protein [Arabidopsis thaliana] gi|332195488|gb|AEE33609.1| putative DNAJ heat shock protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2012743349 AT1G10350 [Arabidopsis thalian 0.593 0.501 0.744 7.3e-105
TAIR|locus:2825170331 AT1G59725 [Arabidopsis thalian 0.596 0.531 0.738 1.1e-101
TAIR|locus:2097880350 AT3G47940 [Arabidopsis thalian 0.6 0.505 0.615 2.1e-90
TAIR|locus:2054809337 AT2G20560 [Arabidopsis thalian 0.593 0.519 0.634 1e-88
TAIR|locus:2097638323 AT3G08910 [Arabidopsis thalian 0.583 0.532 0.651 7.2e-88
TAIR|locus:2121368348 AT4G28480 [Arabidopsis thalian 0.593 0.502 0.617 7.2e-88
TAIR|locus:2179127335 AT5G01390 [Arabidopsis thalian 0.589 0.519 0.643 1e-84
TAIR|locus:2179429347 AT5G25530 [Arabidopsis thalian 0.596 0.507 0.562 3.2e-81
ZFIN|ZDB-GENE-040801-192340 dnajb4 "DnaJ (Hsp40) homolog, 0.589 0.511 0.428 8.7e-65
MGI|MGI:1914285337 Dnajb4 "DnaJ (Hsp40) homolog, 0.579 0.507 0.459 2e-63
TAIR|locus:2012743 AT1G10350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 718 (257.8 bits), Expect = 7.3e-105, Sum P(2) = 7.3e-105
 Identities = 131/176 (74%), Positives = 162/176 (92%)

Query:   117 IETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFPEKG 176
             IE++L CTLEELYKGA+KKM+ISRV+PD FGKP TVQEILKIDIKPGWKKGTKITFPEKG
Sbjct:   174 IESKLACTLEELYKGAKKKMRISRVVPDDFGKPKTVQEILKIDIKPGWKKGTKITFPEKG 233

Query:   177 NQEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLP 236
             NQEPG+ PADLIFVV+EKPH+VF+RDGNDL++  K+SL++ALTGL++++T LDGR+LT+P
Sbjct:   234 NQEPGVTPADLIFVVDEKPHSVFKRDGNDLILEKKVSLIDALTGLTISVTTLDGRSLTIP 293

Query:   237 VTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGG 292
             V DI++PG E+VIPNEGMP +KDP K+G+L + F+I+FPSRLT+EQK+DLKR LGG
Sbjct:   294 VLDIVKPGQEIVIPNEGMP-TKDPLKRGDLRVTFEILFPSRLTSEQKNDLKRVLGG 348


GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2825170 AT1G59725 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097880 AT3G47940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054809 AT2G20560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097638 AT3G08910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121368 AT4G28480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179127 AT5G01390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179429 AT5G25530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-192 dnajb4 "DnaJ (Hsp40) homolog, subfamily B, member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914285 Dnajb4 "DnaJ (Hsp40) homolog, subfamily B, member 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3MI00DNJB1_BOVINNo assigned EC number0.40050.96940.8411yesno
Q9UDY4DNJB4_HUMANNo assigned EC number0.38870.97280.8516yesno
Q9D832DNJB4_MOUSENo assigned EC number0.40940.97280.8516yesno
Q5R8J8DNJB4_PONABNo assigned EC number0.38870.97280.8516yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_VIII2831
SubName- Full=Putative uncharacterized protein; (317 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIII.1526.1
annotation not avaliable (81 aa)
       0.496
grail3.0261001401
hypothetical protein (124 aa)
       0.494
eugene3.02610008
hypothetical protein (132 aa)
       0.494
eugene3.02080009
hypothetical protein (656 aa)
       0.494
eugene3.00130164
hypothetical protein (660 aa)
       0.494
eugene3.00120231
hypothetical protein (668 aa)
       0.494
estExt_fgenesh4_pg.C_1500058
hypothetical protein (706 aa)
       0.494
grail3.0261001101
hypothetical protein (648 aa)
       0.493
fgenesh4_pm.C_LG_III000644
hypothetical protein (651 aa)
       0.493
fgenesh4_pg.C_LG_VIII000455
hypothetical protein (651 aa)
       0.493

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 1e-48
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-38
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-34
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-34
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-32
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 5e-32
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-29
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 1e-29
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-29
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-27
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 7e-26
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-25
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-25
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-24
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-24
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 4e-24
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-23
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 3e-23
pfam0155681 pfam01556, DnaJ_C, DnaJ C terminal domain 3e-23
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 4e-23
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-22
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-22
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-22
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 6e-22
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 4e-21
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-21
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-20
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-20
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 7e-20
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 9e-20
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 9e-20
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-19
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-19
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 6e-19
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 8e-19
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 5e-18
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 6e-18
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-17
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 8e-17
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-16
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-16
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 7e-16
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-15
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-14
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-14
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-14
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 3e-14
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-14
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 9e-14
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 8e-13
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-12
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 5e-12
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 6e-12
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-11
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 5e-11
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 1e-10
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 7e-10
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 7e-10
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-09
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-08
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-08
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 3e-08
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 8e-08
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-07
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-06
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 1e-06
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 5e-05
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 5e-05
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 6e-05
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
 Score =  158 bits (403), Expect = 1e-48
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 12/165 (7%)

Query: 117 IETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQE--ILKIDIKPGWKKGTKITFPE 174
           +   L  TLEE Y G  K++KI R       K   V+E   L + I  G   G ++    
Sbjct: 3   LRYDLELTLEEAYFGKEKEIKIPR-------KVTRVREKKTLTVKIPAGVDDGQRLRLRG 55

Query: 175 KGNQEP-GLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNL 233
           +G+  P G PP DL  V+  KPH VF+RDGNDL     ISL EAL G  + +  L G  +
Sbjct: 56  EGDAGPNGGPPGDLYVVIRVKPHPVFRRDGNDLYCEVPISLTEALLGGEIEVPTLGG-KV 114

Query: 234 TLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRL 278
            L +    QPG+ + +  +GMP       +G+L ++  + FP +L
Sbjct: 115 KLKIPPGTQPGTVLRLKGKGMPR-LRGGGRGDLYVEVKVEFPKKL 158


The C-terminal region of the DnaJ/Hsp40 protein mediates oligomerization and binding to denatured polypeptide substrate. DnaJ/Hsp40 is a widely conserved heat-shock protein. It prevents the aggregation of unfolded substrate and forms a ternary complex with both substrate and DnaK/Hsp70; the N-terminal J-domain of DnaJ/Hsp40 stimulates the ATPase activity of DnaK/Hsp70. Length = 158

>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14288369 chaperone protein DnaJ; Provisional 100.0
PRK14296372 chaperone protein DnaJ; Provisional 100.0
PTZ00037421 DnaJ_C chaperone protein; Provisional 100.0
PRK14286372 chaperone protein DnaJ; Provisional 100.0
PRK14278378 chaperone protein DnaJ; Provisional 100.0
PRK14279392 chaperone protein DnaJ; Provisional 100.0
PRK14295389 chaperone protein DnaJ; Provisional 100.0
PRK14298377 chaperone protein DnaJ; Provisional 100.0
PRK14285365 chaperone protein DnaJ; Provisional 100.0
PRK14282369 chaperone protein DnaJ; Provisional 100.0
PRK14277386 chaperone protein DnaJ; Provisional 100.0
PRK14287371 chaperone protein DnaJ; Provisional 100.0
PRK14281397 chaperone protein DnaJ; Provisional 100.0
PRK14276380 chaperone protein DnaJ; Provisional 100.0
PRK14280376 chaperone protein DnaJ; Provisional 100.0
PRK14297380 chaperone protein DnaJ; Provisional 100.0
PRK14284391 chaperone protein DnaJ; Provisional 100.0
PRK14301373 chaperone protein DnaJ; Provisional 100.0
PRK14294366 chaperone protein DnaJ; Provisional 100.0
PRK14300372 chaperone protein DnaJ; Provisional 100.0
PRK14291382 chaperone protein DnaJ; Provisional 100.0
PRK14299291 chaperone protein DnaJ; Provisional 100.0
PRK14283378 chaperone protein DnaJ; Provisional 100.0
PRK14290365 chaperone protein DnaJ; Provisional 100.0
PRK10767371 chaperone protein DnaJ; Provisional 100.0
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK10266306 curved DNA-binding protein CbpA; Provisional 100.0
PRK14293374 chaperone protein DnaJ; Provisional 100.0
PRK14289386 chaperone protein DnaJ; Provisional 100.0
PRK14292371 chaperone protein DnaJ; Provisional 100.0
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 100.0
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.96
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.95
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 99.89
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.81
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.77
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.75
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.73
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.69
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.66
PHA03102153 Small T antigen; Reviewed 99.66
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.66
PRK01356166 hscB co-chaperone HscB; Provisional 99.54
PRK05014171 hscB co-chaperone HscB; Provisional 99.54
PRK03578176 hscB co-chaperone HscB; Provisional 99.46
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
PRK00294173 hscB co-chaperone HscB; Provisional 99.45
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
PTZ00100116 DnaJ chaperone protein; Provisional 99.38
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.36
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.29
PHA02624 647 large T antigen; Provisional 99.28
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.21
PRK01773173 hscB co-chaperone HscB; Provisional 99.17
PRK14299291 chaperone protein DnaJ; Provisional 99.08
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.04
PRK14282369 chaperone protein DnaJ; Provisional 99.03
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 98.99
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.98
PRK14290365 chaperone protein DnaJ; Provisional 98.92
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.9
PRK14294366 chaperone protein DnaJ; Provisional 98.9
PRK10266306 curved DNA-binding protein CbpA; Provisional 98.89
PRK14285365 chaperone protein DnaJ; Provisional 98.88
PRK14289386 chaperone protein DnaJ; Provisional 98.82
PRK10767371 chaperone protein DnaJ; Provisional 98.82
PRK14284391 chaperone protein DnaJ; Provisional 98.79
PRK14298377 chaperone protein DnaJ; Provisional 98.78
PRK14300372 chaperone protein DnaJ; Provisional 98.78
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 98.76
PRK14279392 chaperone protein DnaJ; Provisional 98.75
PRK14287371 chaperone protein DnaJ; Provisional 98.74
PRK14301373 chaperone protein DnaJ; Provisional 98.73
PRK14295389 chaperone protein DnaJ; Provisional 98.71
PRK14291382 chaperone protein DnaJ; Provisional 98.7
PRK14288369 chaperone protein DnaJ; Provisional 98.7
PRK14293374 chaperone protein DnaJ; Provisional 98.68
PRK14276380 chaperone protein DnaJ; Provisional 98.63
PRK14292371 chaperone protein DnaJ; Provisional 98.6
PRK14280376 chaperone protein DnaJ; Provisional 98.58
PRK14286372 chaperone protein DnaJ; Provisional 98.57
PRK14281397 chaperone protein DnaJ; Provisional 98.57
PRK14283378 chaperone protein DnaJ; Provisional 98.57
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 98.54
PRK14297380 chaperone protein DnaJ; Provisional 98.54
PRK14278378 chaperone protein DnaJ; Provisional 98.51
PRK14277386 chaperone protein DnaJ; Provisional 98.46
PTZ00037421 DnaJ_C chaperone protein; Provisional 98.43
PRK14296372 chaperone protein DnaJ; Provisional 98.42
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.4
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.33
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.13
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.12
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 96.89
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.49
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.75
KOG0431453 consensus Auxilin-like protein and related protein 95.12
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.51
PF1344662 RPT: A repeated domain in UCH-protein 88.69
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 86.58
KOG0724335 consensus Zuotin and related molecular chaperones 86.52
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.2e-75  Score=536.97  Aligned_cols=283  Identities=34%  Similarity=0.578  Sum_probs=244.6

Q ss_pred             CCCCccceecCCCCCCHHHHHHHHHHHHHHhCCCCCCCCcHHHHHHHHHHHHHhhhcCCccccccccCCCCCCCCccCCC
Q 022539            1 MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKASDFG   80 (295)
Q Consensus         1 m~~d~Y~iLgv~~~a~~~eIk~ayr~la~~~hPd~~~~~~~~~~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~~~~~~~~g   80 (295)
                      |.+|||+||||+++||.+|||+|||+||++||||+|+.+ ++|+++|++|++||||||||+||++||+||+.+++.++++
T Consensus         2 ~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~-~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g   80 (371)
T COG0484           2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGD-KEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG   80 (371)
T ss_pred             CccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCC-HHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence            679999999999999999999999999999999999953 6899999999999999999999999999999999855544


Q ss_pred             CCCC--CCCCCCCccccCCCCCCCCCCC-----CCCCCCCCCCeeeecccCHHHHhcCceeEEEEeEEeeC----CC---
Q 022539           81 TPSY--HHPHDTKPCATRNNNNNNHRAG-----GAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPD----HF---  146 (295)
Q Consensus        81 ~~~~--~~~~~~~~f~~~~~~~~~f~~~-----~~~~~~~~~di~~~l~itl~e~~~G~~k~i~~~r~~~~----g~---  146 (295)
                      +.+|  |.....+.|+.      .|+++     .++.++++.|+.+.|+|||+||++|++++|.+.+.+.|    |+   
T Consensus        81 g~g~~~fgg~~~DIF~~------~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak  154 (371)
T COG0484          81 GFGFGGFGGDFGDIFED------FFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAK  154 (371)
T ss_pred             CCCcCCCCCCHHHHHHH------hhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCC
Confidence            3221  11100012221      12211     12456789999999999999999999999999887542    11   


Q ss_pred             --------------C-------------------------------------cEEEEEEEEEEEeCCCCcCCCeEecCCC
Q 022539          147 --------------G-------------------------------------KPITVQEILKIDIKPGWKKGTKITFPEK  175 (295)
Q Consensus       147 --------------G-------------------------------------~~~~~~~~l~V~Ip~G~~~G~~i~~~g~  175 (295)
                                    |                                     ..+.+.++++|+||+|+.+|++|+++|+
T Consensus       155 ~gt~~~tC~tC~G~G~v~~~~~~g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~  234 (371)
T COG0484         155 PGTDPKTCPTCNGSGQVRTVQRTGFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGE  234 (371)
T ss_pred             CCCCCCcCCCCCCcCeEEEEEeeeEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecC
Confidence                          1                                     0577888999999999999999999999


Q ss_pred             CCCCC-CCCCccEEEEEEEeCCcceeecCCceEEEEEecHHHHhcCCEEEEeccCCcEEEEeeCCCCCCCcEEEEcCCCc
Q 022539          176 GNQEP-GLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGM  254 (295)
Q Consensus       176 G~~~~-~~~~GDliv~i~v~~h~~f~r~g~DL~~~~~I~l~~Al~G~~~~i~~l~g~~i~v~i~~~~~~g~~~rl~g~G~  254 (295)
                      |+++. ++++|||||+|.|++|+.|.|+|+||+++++|++.+|++|+++.|+|++|+ ++|+||+++++|+++||+|+||
T Consensus       235 G~~g~~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g~-~~l~ip~Gtq~G~~~rl~gkG~  313 (371)
T COG0484         235 GEAGPNGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKLKIPAGTQTGEVFRLRGKGM  313 (371)
T ss_pred             cccCCCCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEEEEecCCC-EEEecCCCCccCcEEEEcCCCc
Confidence            99986 777899999999999999999999999999999999999999999999998 9999999999999999999999


Q ss_pred             CCCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHhCC
Q 022539          255 PISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALGG  292 (295)
Q Consensus       255 p~~~~~~~~GDL~v~~~v~~P~~l~~~~~~~l~~~l~~  292 (295)
                      |... +..+|||||+++|++|++||.+|+++|+++...
T Consensus       314 p~~~-~~~~GDl~v~v~v~~P~~ls~~q~~lL~~~~~~  350 (371)
T COG0484         314 PKLR-SGGRGDLYVRVKVETPKNLSDEQKELLEEFAKS  350 (371)
T ss_pred             cccC-CCCcCCEEEEEEEEcCCCCCHHHHHHHHHHHHh
Confidence            9765 356799999999999999999999999999863



>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
3agz_A190 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 2e-39
2qld_A183 Human Hsp40 Hdj1 Length = 183 2e-39
3agx_A181 Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi 3e-39
2q2g_A180 Crystal Structure Of Dimerization Domain Of Hsp40 F 4e-38
1c3g_A170 S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 1 9e-27
2b26_A173 The Crystal Structure Of The Protein Complex Of Yea 9e-27
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-20
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-20
1nlt_A248 The Crystal Structure Of Hsp40 Ydj1 Length = 248 5e-20
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-19
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-18
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 5e-17
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 6e-17
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-16
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 6e-16
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 4e-15
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 4e-14
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 6e-14
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-12
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-12
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-12
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-11
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 2e-11
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 9e-11
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-10
1xao_A121 Hsp40-Ydj1 Dimerization Domain Length = 121 6e-09
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 7e-08
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 9e-08
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 5e-07
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 9e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 4e-05
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 1e-04
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 1e-04
>pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 Back     alignment and structure

Iteration: 1

Score = 159 bits (402), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 80/173 (46%), Positives = 123/173 (71%), Gaps = 5/173 (2%) Query: 121 LLCTLEELYKGARKKMKIS--RVLPDHFGKPITVQE-ILKIDIKPGWKKGTKITFPEKGN 177 L +LEE+Y G KKMKIS R+ PD GK I ++ IL I++K GWK+GTKITFP++G+ Sbjct: 18 LRVSLEEIYSGCTKKMKISHKRLNPD--GKSIRNEDKILTIEVKKGWKEGTKITFPKEGD 75 Query: 178 QEPGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPV 237 Q PAD++FV+++KPH +F+RDG+D++ +ISL EAL G ++N+ LDGR + + Sbjct: 76 QTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVF 135 Query: 238 TDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRAL 290 D+I+PG +P EG+P+ K P K+G+LII+F+++FP R+ ++ L++ L Sbjct: 136 KDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVL 188
>pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 Back     alignment and structure
>pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 Back     alignment and structure
>pdb|2Q2G|A Chain A, Crystal Structure Of Dimerization Domain Of Hsp40 From Cryptosporidium Parvum, Cgd2_1800 Length = 180 Back     alignment and structure
>pdb|1C3G|A Chain A, S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 170 Back     alignment and structure
>pdb|2B26|A Chain A, The Crystal Structure Of The Protein Complex Of Yeast Hsp40 Sis1 And Hsp70 Ssa1 Length = 173 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|1XAO|A Chain A, Hsp40-Ydj1 Dimerization Domain Length = 121 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 2e-91
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 4e-89
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 1e-85
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 2e-60
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 7e-48
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-42
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-41
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 4e-41
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 5e-40
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-39
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-35
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 3e-35
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 7e-35
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-34
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-34
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-34
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-34
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-34
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-34
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-33
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-33
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 6e-33
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-32
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-32
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-32
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-28
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 7e-27
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 6e-26
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-24
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-21
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-18
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-18
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 1e-17
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 1e-16
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-14
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-13
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 5e-11
2guz_A71 Mitochondrial import inner membrane translocase su 1e-10
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 1e-09
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
 Score =  268 bits (687), Expect = 2e-91
 Identities = 82/178 (46%), Positives = 115/178 (64%), Gaps = 2/178 (1%)

Query: 114 PTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITVQEILKIDIKPGWKKGTKITFP 173
           P   E  LL TLEELY G RKK+K++R       K    + I++++IKPGWK GTK+T+ 
Sbjct: 3   PRSHEVPLLVTLEELYLGKRKKIKVTRKRFIE-HKVRNEENIVEVEIKPGWKDGTKLTYS 61

Query: 174 EKGNQE-PGLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRN 232
            +G+QE PG  P DL+ +++ K H  F RD   L++   I L+ ALTG +  +T LD RN
Sbjct: 62  GEGDQESPGTSPGDLVLIIQTKTHPRFTRDDCHLIMKVTIPLVRALTGFTCPVTTLDNRN 121

Query: 233 LTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRAL 290
           L +P+ +I+ P +  ++PNEGMPI   P +KG+LI++FDI FP  LT EQK  +K AL
Sbjct: 122 LQIPIKEIVNPKTRKIVPNEGMPIKNQPGQKGDLILEFDICFPKSLTPEQKKLIKEAL 179


>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 100.0
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 100.0
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 100.0
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 100.0
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 100.0
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.95
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.94
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.9
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.88
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.88
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.87
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.86
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.86
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.85
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.85
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.84
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.84
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.83
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.82
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.81
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.79
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.78
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.77
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.75
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.75
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.75
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.75
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.72
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.7
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.69
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.69
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.69
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.69
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.67
2guz_A71 Mitochondrial import inner membrane translocase su 99.65
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.63
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.62
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.09
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.08
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 98.94
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 98.92
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 98.89
2guz_B65 Mitochondrial import inner membrane translocase su 98.86
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 98.81
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 98.7
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 93.96
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
Probab=100.00  E-value=5e-68  Score=488.77  Aligned_cols=276  Identities=24%  Similarity=0.368  Sum_probs=164.6

Q ss_pred             CCccceecCCCCCCHHHHHHHHHHHHHHhCCCCCCCCcHHHHHHHHHHHHHhhhcCCccccccccCCCCCCCCcc---CC
Q 022539            3 VDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDPRKRQIYDLYGPEGLKAS---DF   79 (295)
Q Consensus         3 ~d~Y~iLgv~~~a~~~eIk~ayr~la~~~hPd~~~~~~~~~~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~~~~~~---~~   79 (295)
                      +|||+||||+++||.+|||+|||+||++||||+|++  ..|+++|++|++||++|+||.+|+.||+|+..+...+   .+
T Consensus        28 ~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~--~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~  105 (329)
T 3lz8_A           28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKE--NDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQR  105 (329)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCC--hHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccccc
Confidence            799999999999999999999999999999999975  3688999999999999999999999999854422111   01


Q ss_pred             C--CCCCCCCCCC-CccccCCCCCCCCCCC----CCCCCCCCCCeeeecccCHHHHhcCceeEEEEeEEeeCCCCcEEEE
Q 022539           80 G--TPSYHHPHDT-KPCATRNNNNNNHRAG----GAGPKPTPTPIETQLLCTLEELYKGARKKMKISRVLPDHFGKPITV  152 (295)
Q Consensus        80 g--~~~~~~~~~~-~~f~~~~~~~~~f~~~----~~~~~~~~~di~~~l~itl~e~~~G~~k~i~~~r~~~~g~G~~~~~  152 (295)
                      +  +++ |...+. ..|..      .|+++    +.+.++++.|+.++|.|||+|+|+|+++++.+.+.++++.|+++..
T Consensus       106 ~~~~~~-f~~~~f~diF~~------~Fg~~g~~~~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~g~G~v~~~  178 (329)
T 3lz8_A          106 QTHEQS-YSQQDFDDIFSS------MFGQQAHQRRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYNVFGMIESE  178 (329)
T ss_dssp             --------------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECCSCC-CCEE
T ss_pred             ccccCC-cCCCchhhhhHh------hhcCcCCCCCCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeecCCeEEEEe
Confidence            0  011 110000 11211      12211    1123567999999999999999999999999999999988875443


Q ss_pred             -EEEEEEEeCCCCcCCCeEecCCCCCCCC-CCCCccEEEEEEEeCCcceeecCCceEEEEEecHHHHhcCCEEEEeccCC
Q 022539          153 -QEILKIDIKPGWKKGTKITFPEKGNQEP-GLPPADLIFVVEEKPHAVFQRDGNDLVVNHKISLLEALTGLSLNLTALDG  230 (295)
Q Consensus       153 -~~~l~V~Ip~G~~~G~~i~~~g~G~~~~-~~~~GDliv~i~v~~h~~f~r~g~DL~~~~~I~l~~Al~G~~~~i~~l~g  230 (295)
                       .++++|+||||+++|++|+|+|+|++++ ++.+|||+|+|+++||+.|+|+|+||+++++|++++|+||++++|+|+||
T Consensus       179 ~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~VptLdG  258 (329)
T 3lz8_A          179 TPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKE  258 (329)
T ss_dssp             EEEEEEEEECTTCCTTCEEEESSCSCCC---CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEEECCSSS
T ss_pred             cceEEEEeCCCCCCCCCEEEEcccccCCCCCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEEEECCCC
Confidence             6789999999999999999999999974 67899999999999999999999999999999999999999999999999


Q ss_pred             cEEEEeeCCCCCCCcEEEEcCCCcCCCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHhC
Q 022539          231 RNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSRLTAEQKSDLKRALG  291 (295)
Q Consensus       231 ~~i~v~i~~~~~~g~~~rl~g~G~p~~~~~~~~GDL~v~~~v~~P~~l~~~~~~~l~~~l~  291 (295)
                      + ++|+||+++++|+++||+|+|||..   +.+|||||+|+|.||+.||++|+++|+++..
T Consensus       259 ~-v~l~ip~gt~~g~~~rl~G~GmP~~---~~rGDL~v~~~V~~P~~l~~~q~~~l~~~~~  315 (329)
T 3lz8_A          259 S-ILLTVPPGSQAGQRLRIKGKGLVSK---THTGDLFAVIKIVMPTKPDEKARELWQQLAA  315 (329)
T ss_dssp             C-EEEEECTTCCTTCEEEETTCSCBCS---SCBCCEEEEEEECCCSSCCHHHHHHHHHHHH
T ss_pred             C-EEEEECCCCCCCCEEEEcCCCCCCC---CCCCCEEEEEEEECCCCCCHHHHHHHHHHHh
Confidence            7 7999999999999999999999965   3689999999999999999999999999865



>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-23
d1c3ga290 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba 5e-23
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-22
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 6e-20
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 9e-19
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-18
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-17
d1nlta280 b.4.1.1 (A:258-337) Mitochondrial protein import p 3e-17
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-17
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-16
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-14
d1nlta174 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei 2e-11
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 88.6 bits (219), Expect = 3e-23
 Identities = 45/77 (58%), Positives = 61/77 (79%), Gaps = 2/77 (2%)

Query: 1  MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDKNPATNQQAEAKFKLISEAYDVLSDP 60
          MG DYY  L ++RGA+++++K++Y+R A+++HPDKN      AE KFK I+EAYDVLSDP
Sbjct: 1  MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNK--EPGAEEKFKEIAEAYDVLSDP 58

Query: 61 RKRQIYDLYGPEGLKAS 77
          RKR+I+D YG EGLK S
Sbjct: 59 RKREIFDRYGEEGLKGS 75


>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.94
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.91
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.85
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.82
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.79
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.79
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.74
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.74
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.72
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.51
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.1
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.05
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 98.97
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: HSP40/DnaJ peptide-binding domain
superfamily: HSP40/DnaJ peptide-binding domain
family: HSP40/DnaJ peptide-binding domain
domain: Heat shock protein 40 Sis1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94  E-value=1.3e-27  Score=178.05  Aligned_cols=90  Identities=38%  Similarity=0.725  Sum_probs=86.0

Q ss_pred             ceeecCCceEEEEEecHHHHhcCCEEEEeccCCcEEEEeeCCCCCCCcEEEEcCCCcCCCCCCCCCCCEEEEEEEECCCC
Q 022539          198 VFQRDGNDLVVNHKISLLEALTGLSLNLTALDGRNLTLPVTDIIQPGSEVVIPNEGMPISKDPSKKGNLIIKFDIMFPSR  277 (295)
Q Consensus       198 ~f~r~g~DL~~~~~I~l~~Al~G~~~~i~~l~g~~i~v~i~~~~~~g~~~rl~g~G~p~~~~~~~~GDL~v~~~v~~P~~  277 (295)
                      .|+|+|+||+++++||+.||++|++++|+|+||+++.|++|+++++|++++|+|+|||...+++.+|||||+|+|.+|++
T Consensus         1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i~ip~~~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~P~~   80 (90)
T d1c3ga2           1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPIS   80 (90)
T ss_dssp             SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEEEESSCCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBCCSS
T ss_pred             CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceecccccccccccccccCCCCCCcCCCCCCcCCEEEEEEEEcCCC
Confidence            49999999999999999999999999999999999999999999999999999999998876678999999999999999


Q ss_pred             CCHHHHHHHH
Q 022539          278 LTAEQKSDLK  287 (295)
Q Consensus       278 l~~~~~~~l~  287 (295)
                      ||++|+++|+
T Consensus        81 ls~~qk~~lE   90 (90)
T d1c3ga2          81 LNDAQKRAID   90 (90)
T ss_dssp             CCTTHHHHTC
T ss_pred             CCHHHHHhhC
Confidence            9999999874



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure