Citrus Sinensis ID: 022545

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----

MGFLDTCWRLLLLSKLILTWPLTMWRTILREVLKEQLLLLLLLFQLSLRKARLRCLSRETGSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGKSVKVAVLAQGEKFNEAKNAGADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKLPSNF

ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHccccccccEEEHHHccccccccccccccEEEcccccccEEEEEEEEccccHHHHHHccccccccHHHHHHHHcccccCEEEEEccccHHHHHHHcccccccccccccccccccccHHHHHHHHHcccEEEECccccccccccccccccHHHHHHHHHHHHHHHHcccccccccCEEEEEEEEccccccEEEcHHHHHcccccccc

*GFLDTCWRLLLLSKLILTWPLTMWRTILREVLKEQLLLLLLLFQLSLRKARLRCLSRETGSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGKSVKVAVLAQGEKFNEAKNAGADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDY******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L1, chloroplastic	This protein binds directly to 23S ribosomal RNA.	probable	Q9LY66
50S ribosomal protein L1	Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA.	probable	Q2II81
50S ribosomal protein L1	Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA.	probable	B7KIR7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain D
Confidence level:very confident
Coverage over the Query: 59-285
View the alignment between query and template
View the model in PyMOL