Citrus Sinensis ID: 022562

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----

MSGTGDSSAVNGGGCEIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDNSSNCNNNNNKDDVAAAGYASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSVAATPMEEELVDHQDHNPSQSYPLLPPTPAETSNKSGGFSMMPALPVVLPVPIENPMENLTLGQNSQRTAGEATRLIRPVPVPVLPAAQPSSTVSDLNLNLNLAVDPPPLSQRESSSRHSAFQVMQTFNNGDSNSIISVA

ccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcc

************GGCEIMLFGVRVVVDS************************************************************WTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLR*****************************************************************PVVLPV**********************************************************************************NSIISVA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor MYB1R1	Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance.	probable	Q2V9B0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CU7, chain A
Confidence level:confident
Coverage over the Query: 83-150
View the alignment between query and template
View the model in PyMOL