Citrus Sinensis ID: 022562

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MSGTGDSSAVNGGGCEIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDNSSNCNNNNNKDDVAAAGYASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSVAATPMEEELVDHQDHNPSQSYPLLPPTPAETSNKSGGFSMMPALPVVLPVPIENPMENLTLGQNSQRTAGEATRLIRPVPVPVLPAAQPSSTVSDLNLNLNLAVDPPPLSQRESSSRHSAFQVMQTFNNGDSNSIISVA
ccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcc
cccccccccccccccEEEEEEEEEEcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEcccHHHHHHHHHHHHHHHcccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEc
msgtgdssavngggceIMLFGVRVVVDSMRksvslnnlsqyeqpqdnssncnnnnnkddvaaagyasaddgvhnnssrasrerkrgvpwteEEHKLFLLGLqkvgkgdwrgisrnfvktrtptqvaSHAQKYFLRRSNlnrrrrrsslfdittdsvaatpmeeelvdhqdhnpsqsypllpptpaetsnksggfsmmpalpvvlpvpienpmenltlgqnsqrtageatrlirpvpvpvlpaaqpsstvsdlnlnlnlavdppplsqresssrhSAFQVMQTfnngdsnsIISVA
msgtgdssavngggcEIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDNSSNCNNNNNKDDVAAAGYAsaddgvhnnssrasrerkrgvpwteeeHKLFLlglqkvgkgdwRGISRnfvktrtptqvashaqkyflrrsnlnrrrrrsslfdittdsvaaTPMEEELVDHQDHNPSQSYPLLPPTPAETSNKSGGFSMMPALPVVLPVPIENPMENLTLGQNSQRTAGEATRLIRPVPVPVLPAAQPSSTVSDLNLNLNLAVDPPPLSQRESSSRHSAFQVMQtfnngdsnsiisva
MSGTGDSSAVNGGGCEIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDnssncnnnnnKDDVAAAGYASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFlrrsnlnrrrrrsslFDITTDSVAATPMEEELVDHQDHNPSQSYPLLPPTPAETSNKSGGFSMMPAlpvvlpvpIENPMENLTLGQNSQRTAGEATRLIRpvpvpvLPAAQPSSTVSDLNLNLNLAVDPPPLSQRESSSRHSAFQVMQTFNNGDSNSIISVA
***********GGGCEIMLFGVRVVVDS************************************************************WTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLR*****************************************************************PVVLPV*****************************************************************************************
******************LFGVRVVVDS****************************************************************EHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY************************************************************************************************************************************************************NSIISVA
*********VNGGGCEIMLFGVRVVVDSMRKSVSLNNLS**********NCNNNNNKDDVAAAGYASAD*******************WTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSVAATPMEEELVDHQDHNPSQSYPLLPPTPAETSNKSGGFSMMPALPVVLPVPIENPMENLTLG*********ATRLIRPVPVPVLPAAQPSSTVSDLNLNLNLAVDPP***********SAFQVMQTFNNGDSNSIISVA
************GGCEIMLFGVRVVVDSMRKSVSLNNLSQ*********************************************GVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSN*********************************************************MMPALPVVLPVPIENPMENLTLGQN********TRLIRPVPVPVLPA*****************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGTGDSSAVNGGGCEIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDNSSNCNNNNNKDDVAAAGYASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSVAATPMEEELVDHQDHNPSQSYPLLPPTPAETSNKSGGFSMMPALPVVLPVPIENPMENLTLGQNSQRTAGEATRLIRPVPVPVLPAAQPSSTVSDLNLNLNLAVDPPPLSQRESSSRHSAFQVMQTFNNGDSNSIISVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q2V9B0297 Transcription factor MYB1 N/A no 0.915 0.909 0.564 8e-63
Q8S9H7307 Transcription factor DIVA N/A no 0.281 0.270 0.690 1e-27
Q869R9 734 Myb-like protein J OS=Dic yes no 0.216 0.087 0.507 3e-12
Q54HX6 977 Myb-like protein I OS=Dic no no 0.216 0.065 0.470 2e-09
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.257 0.062 0.378 1e-07
Q6R0H0287 Transcription factor ASG4 no no 0.152 0.156 0.489 2e-05
Q54IF9 423 Myb-like protein G OS=Dic no no 0.152 0.106 0.468 3e-05
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.172 0.079 0.392 0.0001
P92973 608 Protein CCA1 OS=Arabidops no no 0.172 0.083 0.410 0.0001
Q86HX9894 Myb-like protein K OS=Dic no no 0.149 0.049 0.422 0.0006
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function desciption
 Score =  240 bits (613), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 209/301 (69%), Gaps = 31/301 (10%)

Query: 9   AVNGGGC--EIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDNSSNCNNNNNKDDVAA--AG 64
           AV GGG   EIMLFGVRV VD MRKSVSLN+LSQYE P  N++N   +NN+    A   G
Sbjct: 14  AVTGGGFGGEIMLFGVRVKVDPMRKSVSLNDLSQYEHPNANNNNNGGDNNESSKVAQDEG 73

Query: 65  YASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQ 124
           YASADD V + S+ + RERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQ
Sbjct: 74  YASADDAVQHQSN-SGRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQ 132

Query: 125 VASHAQKYFLRRSNLNRRRRRSSLFDITTDSVAATPMEEELVDHQDHNPSQSYPLLPPTP 184
           VASHAQKYFLRRSNLNRRRRRSSLFDITTDSV+  P+EE  V+++     Q  P++ P  
Sbjct: 133 VASHAQKYFLRRSNLNRRRRRSSLFDITTDSVSVMPIEE--VENK-----QEIPVVAPAT 185

Query: 185 AETSNKSGGFSMMPAL-PVVLPVPIENPMENLTLGQNSQRTAGEATRLIRPVPVPVLPAA 243
             T+ K+  F + P + P++ PV I+   E  TL ++     G ++ L+ PVP+  +P  
Sbjct: 186 LPTT-KTNAFPVAPTVGPIIFPVQIDKSREYPTLLRHDH---GNSSMLVGPVPMFSMP-- 239

Query: 244 QPSSTVSDLNLNLNLAVDPPPLSQ---------RESSSRHSAFQVMQTFNNGDSNSIISV 294
            PS+ + DLN N N  ++P  LS          + SS+RHSA+ VM +F+NG+  SII V
Sbjct: 240 NPSTAI-DLNANHNSTIEPSSLSLRLSLSLDQGQASSTRHSAYNVMSSFSNGE--SIIRV 296

Query: 295 A 295
           A
Sbjct: 297 A 297
Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance.
Solanum tuberosum (taxid: 4113)
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function description
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q86HX9|MYBK_DICDI Myb-like protein K OS=Dictyostelium discoideum GN=mybK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
255540827319 DNA binding protein, putative [Ricinus c 0.905 0.836 0.650 8e-82
28629811302 transcription factor Myb1 [Malus xiaojin 0.925 0.903 0.63 4e-78
302398989300 MYBR domain class transcription factor [ 0.955 0.94 0.607 8e-77
302398981302 MYBR domain class transcription factor [ 0.935 0.913 0.629 2e-75
289466353317 MYB transcription factor 1 [Vitis pseudo 0.891 0.829 0.642 7e-73
156145914294 myb transcription factor [Rosa hybrid cu 0.911 0.914 0.589 8e-71
147817140305 hypothetical protein VITISV_040763 [Viti 0.867 0.839 0.663 8e-71
225457178323 PREDICTED: transcription factor MYB1R1-l 0.867 0.792 0.663 2e-70
289466355305 MYB transcription factor 2 [Vitis pseudo 0.867 0.839 0.653 6e-69
254679865285 isoflavonoid regulator [Glycine max] 0.884 0.915 0.598 1e-68
>gi|255540827|ref|XP_002511478.1| DNA binding protein, putative [Ricinus communis] gi|223550593|gb|EEF52080.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  309 bits (792), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 229/312 (73%), Gaps = 45/312 (14%)

Query: 16  EIMLFGVRVVVDSMRKSVSLNNLSQYEQPQD----------------NSSNCNNNNNKDD 59
           EIMLFGVRVVVDSMRKSVSLNNLSQYEQPQD                + +N N+  +KDD
Sbjct: 21  EIMLFGVRVVVDSMRKSVSLNNLSQYEQPQDFNNNNSSSSSNNNNNKHVTNSNSKKDKDD 80

Query: 60  VAAAGYASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKT 119
           +AA+GYASADD V + SS A  ERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKT
Sbjct: 81  MAASGYASADDAVPH-SSNARGERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKT 139

Query: 120 RTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDSVAATPMEEELVDHQDHNPS-QSYP 178
           RTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTD+V A PMEEE    QD++ S QS+P
Sbjct: 140 RTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDTVTAFPMEEEQARRQDNSSSPQSHP 199

Query: 179 LLPPTPAETSNKS----GGFSMMPALPVVLPVPIENPMENLTLGQNSQRTAGEATRLIRP 234
           L PP P ETSN S      FSM  + PVVLP+PIE PM+NL+L Q     A  +T LIR 
Sbjct: 200 LPPPLP-ETSNFSVMSMPAFSMTSS-PVVLPIPIETPMQNLSLLQ-----ANSSTTLIR- 251

Query: 235 VPVPVLPAAQPSSTVSDLNLNLNLAVDPPP-LS--------QRE--SSSRHSAFQVMQTF 283
            P+ V+PA  P+S +SD+NLNL  + D  P LS        QRE  SS+R+SAFQVM +F
Sbjct: 252 -PIAVIPAP-PTSGISDINLNLKASTDSSPNLSLKLSLPSDQRESPSSTRYSAFQVMPSF 309

Query: 284 NNGDSNSIISVA 295
           NNGD   II+VA
Sbjct: 310 NNGD--GIITVA 319

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|28629811|gb|AAO45179.1| transcription factor Myb1 [Malus xiaojinensis] Back     alignment and taxonomy information
>gi|302398989|gb|ADL36789.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|302398981|gb|ADL36785.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|289466353|gb|ADC94862.1| MYB transcription factor 1 [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|156145914|gb|ABU53684.1| myb transcription factor [Rosa hybrid cultivar] Back     alignment and taxonomy information
>gi|147817140|emb|CAN77681.1| hypothetical protein VITISV_040763 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225457178|ref|XP_002283896.1| PREDICTED: transcription factor MYB1R1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|289466355|gb|ADC94863.1| MYB transcription factor 2 [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|254679865|gb|ACT78579.1| isoflavonoid regulator [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2011216285 AT1G19000 [Arabidopsis thalian 0.566 0.585 0.543 2.6e-47
TAIR|locus:2027181265 AT1G74840 [Arabidopsis thalian 0.593 0.660 0.561 1.3e-43
TAIR|locus:2020653261 AT1G70000 [Arabidopsis thalian 0.698 0.789 0.459 1.6e-38
TAIR|locus:2094942387 AT3G16350 [Arabidopsis thalian 0.338 0.258 0.586 4.6e-36
TAIR|locus:2171519365 AT5G47390 [Arabidopsis thalian 0.528 0.427 0.481 3.1e-35
TAIR|locus:2151621317 AT5G61620 [Arabidopsis thalian 0.505 0.470 0.401 1.1e-25
TAIR|locus:2154508288 AT5G58900 [Arabidopsis thalian 0.277 0.284 0.639 1.7e-25
TAIR|locus:2028461314 AT1G49010 [Arabidopsis thalian 0.427 0.401 0.459 1.8e-25
TAIR|locus:2042872298 AT2G38090 [Arabidopsis thalian 0.430 0.426 0.480 5.9e-25
UNIPROTKB|Q8S9H7307 DIVARICATA "Transcription fact 0.355 0.342 0.536 4.2e-24
TAIR|locus:2011216 AT1G19000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 425 (154.7 bits), Expect = 2.6e-47, Sum P(2) = 2.6e-47
 Identities = 100/184 (54%), Positives = 115/184 (62%)

Query:     2 SGTGDSSAVNGGGCEIMLFGVRVVVDSMRKSVSLNNLSQYEQ--PQDXXXXXXXXXXKDD 59
             S TGD   V G   EIMLFGVRVVVD MRK VSLNNLS YE+  P+D           D 
Sbjct:     8 SETGDCG-VTGKRDEIMLFGVRVVVDPMRKCVSLNNLSDYEKSSPEDEIPKIVTAGAGDG 66

Query:    60 ----------VAAAGYASADDGVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDW 109
                       + A GYASA+D V  +SS  S  RKRGVPWTE EHK FL+GLQKVGKGDW
Sbjct:    67 EDKNETDATVIVADGYASANDAVQISSS--SGGRKRGVPWTENEHKRFLIGLQKVGKGDW 124

Query:   110 RGISRNFVKTRTPTQVASHAQKYFXXXXXXXXXXXXXXXFDITTDSVAATPMEEELVDHQ 169
             +GISRNFVK+RTPTQVASHAQKYF               FDITT++V    ME++    Q
Sbjct:   125 KGISRNFVKSRTPTQVASHAQKYFLRRTNLNRRRRRSSLFDITTETVTEMAMEQDPT--Q 182

Query:   170 DHNP 173
             +++P
Sbjct:   183 ENSP 186
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2027181 AT1G74840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020653 AT1G70000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094942 AT3G16350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171519 AT5G47390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151621 AT5G61620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2V9B0MY1R1_SOLTUNo assigned EC number0.56470.91520.9090N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016181001
SubName- Full=Putative uncharacterized protein (Chromosome chr17 scaffold_12, whole genome shotgun sequence); (305 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 1e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-10
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 3e-05
cd1166146 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma 4e-05
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 72.4 bits (178), Expect = 1e-16
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 84  KRGVPWTEEEHKLFLLGLQKVGKGDW---RGISRNFVKTR-TPTQVASHAQKYFLRR 136
           K  V WTE+ H  FL  +QK+G  DW   + I    V    T  QVASH QKY L++
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.72
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.5
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.2
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.19
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.94
PLN03212249 Transcription repressor MYB5; Provisional 98.79
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.77
PLN03091 459 hypothetical protein; Provisional 98.7
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.49
KOG0724335 consensus Zuotin and related molecular chaperones 98.31
PLN03212249 Transcription repressor MYB5; Provisional 98.26
PLN03091 459 hypothetical protein; Provisional 98.19
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.1
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.01
KOG4329445 consensus DNA-binding protein [General function pr 97.93
KOG1279506 consensus Chromatin remodeling factor subunit and 97.87
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.76
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.58
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.01
PLN03162526 golden-2 like transcription factor; Provisional 96.79
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.24
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.74
KOG4167907 consensus Predicted DNA-binding protein, contains 95.45
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.11
KOG4468 782 consensus Polycomb-group transcriptional regulator 94.81
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 94.81
KOG0051607 consensus RNA polymerase I termination factor, Myb 94.7
smart0042668 TEA TEA domain. 94.53
COG5147 512 REB1 Myb superfamily proteins, including transcrip 94.0
KOG3841 455 consensus TEF-1 and related transcription factor, 93.77
KOG0051607 consensus RNA polymerase I termination factor, Myb 93.74
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.38
KOG0724335 consensus Zuotin and related molecular chaperones 93.18
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.14
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 91.75
KOG1194 534 consensus Predicted DNA-binding protein, contains 91.55
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 90.65
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 89.52
COG5147 512 REB1 Myb superfamily proteins, including transcrip 89.29
KOG4282345 consensus Transcription factor GT-2 and related pr 89.07
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 88.1
PLN031421033 Probable chromatin-remodeling complex ATPase chain 83.42
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 81.27
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.72  E-value=7.2e-18  Score=124.84  Aligned_cols=53  Identities=47%  Similarity=0.684  Sum_probs=47.7

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCCCCh---hhhhhhhcCCC-CHHHHHHHHHHHHHHh
Q 022562           84 KRGVPWTEEEHKLFLLGLQKVGKGDW---RGISRNFVKTR-TPTQVASHAQKYFLRR  136 (295)
Q Consensus        84 kk~~~WTeEEh~~FLegL~kyGkGdW---k~IAr~~V~TR-T~~QVrSHAQKYF~rl  136 (295)
                      |.+..||+|||++||+||+.||.|+|   +.|++.++.+| |+.||+||+||||+++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k~   57 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ   57 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHccC
Confidence            45678999999999999999999999   99995556688 9999999999999863

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-27
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-22
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-16
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-16
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-16
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-10
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-10
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 3e-10
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-09
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 1e-08
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 1e-07
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-07
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 6e-07
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 1e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-06
2crg_A70 Metastasis associated protein MTA3; transcription 1e-06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 2e-06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 4e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 6e-05
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score =  101 bits (253), Expect = 1e-27
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 79  ASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSN 138
           +S      V WT EE +LF  GL K G+  W  IS+  + +RT  QV S+A++YF  +  
Sbjct: 2   SSGSSGYSVKWTIEEKELFEQGLAKFGR-RWTKISK-LIGSRTVLQVKSYARQYFKNKVK 59

Query: 139 LNRRRRRSS 147
               +   +
Sbjct: 60  CGLDKETPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.66
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.56
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.55
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.46
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.43
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.43
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.38
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.36
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.35
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.32
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.32
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.26
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.25
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.22
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.22
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.82
2crg_A70 Metastasis associated protein MTA3; transcription 99.18
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.18
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.17
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.16
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.12
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.12
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.1
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.1
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.08
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.07
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.06
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.05
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.03
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.98
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.97
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.92
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.91
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.9
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.87
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.86
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.85
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.77
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.67
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.53
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.34
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.62
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.43
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.41
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.31
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.93
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.77
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.71
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.66
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.51
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 95.29
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.15
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 93.87
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.66
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 94.03
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.01
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 81.51
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 80.47
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.66  E-value=1.4e-16  Score=119.55  Aligned_cols=66  Identities=33%  Similarity=0.527  Sum_probs=60.8

Q ss_pred             ccCCCCCCHHHHHHHHHHHHHhCCCChhhhhhhhcCCCCHHHHHHHHHHHHHHhhhcccccCCCcccc
Q 022562           83 RKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFD  150 (295)
Q Consensus        83 rkk~~~WTeEEh~~FLegL~kyGkGdWk~IAr~~V~TRT~~QVrSHAQKYF~rl~~~~k~krR~Sl~d  150 (295)
                      ..+..+||+|||++|++++++||. +|..|| .+|++||..||+.||++||.+..+.+..+++.+||+
T Consensus         6 ~~~~~~WT~eEd~~l~~~~~~~G~-~W~~Ia-~~~~~Rt~~q~k~r~~~~l~~~~~~g~~~~~~si~s   71 (72)
T 2cu7_A            6 SGYSVKWTIEEKELFEQGLAKFGR-RWTKIS-KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKT   71 (72)
T ss_dssp             SSCCCCCCHHHHHHHHHHHHHTCS-CHHHHH-HHHSSSCHHHHHHHHHHHHHHHSCSCTTCCCSCCCC
T ss_pred             CcCCCCCCHHHHHHHHHHHHHHCc-CHHHHH-HHcCCCCHHHHHHHHHHHHHHHHhcCCCCCcccccc
Confidence            345668999999999999999999 999999 799999999999999999999988888888999885
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 1e-19
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 1e-19
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-12
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 7e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-07
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-06
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-05
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 4e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.001
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 0.002
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 78.8 bits (194), Expect = 1e-19
 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 3/63 (4%)

Query: 80  SRERKRGVPWTEEEHKLFLLGLQKVGKGDWR--GISRN-FVKTRTPTQVASHAQKYFLRR 136
           + ++K  V WT E H  FL  +  +G        I     V   T   VASH QK+ +  
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60

Query: 137 SNL 139
             +
Sbjct: 61  KKV 63
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.63
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.58
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.54
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.41
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.36
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.35
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.33
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.32
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.31
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.28
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.26
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.2
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.04
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.94
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.52
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.42
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.83
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.4
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 92.31
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 91.8
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 89.02
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Transcriptional adaptor 2-like, TADA2L, isoform b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.63  E-value=1.1e-16  Score=110.89  Aligned_cols=45  Identities=31%  Similarity=0.644  Sum_probs=43.7

Q ss_pred             CCCHHHHHHHHHHHHHhCCCChhhhhhhhcCCCCHHHHHHHHHHHH
Q 022562           88 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYF  133 (295)
Q Consensus        88 ~WTeEEh~~FLegL~kyGkGdWk~IAr~~V~TRT~~QVrSHAQKYF  133 (295)
                      .||+||+.+|++++++||.++|+.|| ++|++||+.||+.|+++||
T Consensus         3 ~Wt~eEd~~L~~~v~~~G~~nW~~Ia-~~~~~Rt~~Qcr~r~~~~f   47 (47)
T d1x41a1           3 SWTAQEEMALLEAVMDCGFGNWQDVA-NQMCTKTKEECEKHYMKYF   47 (47)
T ss_dssp             SSCHHHHHHHHHHHHHTCTTCHHHHH-HHHTTSCHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHCCccHHHHH-HHcCCCCHHHHHHHHHHhC
Confidence            49999999999999999999999999 8999999999999999998
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure