Citrus Sinensis ID: 022584
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 295 | 2.2.26 [Sep-21-2011] | |||||||
| O65390 | 506 | Aspartic proteinase A1 OS | yes | no | 1.0 | 0.583 | 0.657 | 1e-119 | |
| P42211 | 496 | Aspartic proteinase OS=Or | yes | no | 0.993 | 0.590 | 0.647 | 1e-118 | |
| O04057 | 513 | Aspartic proteinase OS=Cu | N/A | no | 1.0 | 0.575 | 0.677 | 1e-118 | |
| Q42456 | 509 | Aspartic proteinase oryza | no | no | 0.989 | 0.573 | 0.654 | 1e-116 | |
| Q8VYL3 | 513 | Aspartic proteinase A2 OS | no | no | 0.996 | 0.573 | 0.629 | 1e-114 | |
| P42210 | 508 | Phytepsin OS=Hordeum vulg | N/A | no | 1.0 | 0.580 | 0.651 | 1e-110 | |
| P40782 | 473 | Cyprosin (Fragment) OS=Cy | N/A | no | 1.0 | 0.623 | 0.608 | 1e-109 | |
| Q9XFX4 | 506 | Procardosin-B OS=Cynara c | N/A | no | 0.996 | 0.581 | 0.585 | 1e-108 | |
| Q9XEC4 | 508 | Aspartic proteinase A3 OS | no | no | 1.0 | 0.580 | 0.589 | 1e-106 | |
| Q9XFX3 | 504 | Procardosin-A OS=Cynara c | N/A | no | 0.996 | 0.583 | 0.577 | 3e-99 |
| >sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 428 bits (1100), Expect = e-119, Method: Compositional matrix adjust.
Identities = 196/298 (65%), Positives = 239/298 (80%), Gaps = 3/298 (1%)
Query: 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDI 60
M++QGL+ E VFSFWLNR+ D EEGGE+VFGGVDP HFKGKHTYVPVT+KGYWQF++GD+
Sbjct: 209 MLKQGLIKEPVFSFWLNRNADEEEGGELVFGGVDPNHFKGKHTYVPVTQKGYWQFDMGDV 268
Query: 61 LIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLI 120
LIG TG CE GC+AI DSGTSLLAGPT ++T INHAIG GVVS +CK VV QYG I
Sbjct: 269 LIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGVVSQQCKTVVDQYGQTI 328
Query: 121 WDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD---SAVCSACEMAVV 177
DLL+S P+K+C QIGLC F+G VS GI++VV+KEN + A CSACEMAVV
Sbjct: 329 LDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEMAVV 388
Query: 178 WVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPE 237
W+Q+QL+Q T+E++L+Y+NELC+ LP+PMGES +DC ++ TMP VS TIG K+F+L+PE
Sbjct: 389 WIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDLAPE 448
Query: 238 QYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 295
+Y+LK GEG CISGF+A D+ PPRGPLWILGDVFMG YHTVFD G ++GFAEAA
Sbjct: 449 EYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEAA 506
|
Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles (By similarity). Possesses aspartic protease activity in vitro. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 3EC: .EC: - |
| >sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P42210|ASPR_HORVU Phytepsin OS=Hordeum vulgare PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 295 | ||||||
| 224124910 | 507 | predicted protein [Populus trichocarpa] | 1.0 | 0.581 | 0.724 | 1e-131 | |
| 171854659 | 506 | putative aspartic protease [Capsicum chi | 1.0 | 0.583 | 0.717 | 1e-129 | |
| 294440430 | 506 | aspartic protease 1 [Nicotiana tabacum] | 0.996 | 0.581 | 0.719 | 1e-129 | |
| 82623417 | 506 | aspartic protease precursor-like [Solanu | 1.0 | 0.583 | 0.713 | 1e-128 | |
| 418731269 | 372 | aspartic protease, partial [Solanum tube | 1.0 | 0.793 | 0.713 | 1e-127 | |
| 12231178 | 505 | aspartic proteinase 4 [Nepenthes alata] | 0.996 | 0.582 | 0.721 | 1e-127 | |
| 350535356 | 506 | aspartic protease precursor [Solanum lyc | 1.0 | 0.583 | 0.707 | 1e-127 | |
| 50540937 | 497 | Asp [Solanum tuberosum] | 0.993 | 0.589 | 0.708 | 1e-126 | |
| 357511707 | 504 | Aspartic proteinase [Medicago truncatula | 1.0 | 0.585 | 0.707 | 1e-125 | |
| 357511709 | 478 | Aspartic proteinase [Medicago truncatula | 1.0 | 0.617 | 0.707 | 1e-125 |
| >gi|224124910|ref|XP_002319454.1| predicted protein [Populus trichocarpa] gi|222857830|gb|EEE95377.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 473 bits (1216), Expect = e-131, Method: Compositional matrix adjust.
Identities = 216/298 (72%), Positives = 260/298 (87%), Gaps = 3/298 (1%)
Query: 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDI 60
M++Q LV +EVFSFWLNR+P+A+EGGE+VFGGVDPKHFKGKHTYVPVT+KGYWQ +GD
Sbjct: 210 MIQQDLVDDEVFSFWLNRNPEAKEGGELVFGGVDPKHFKGKHTYVPVTQKGYWQINMGDF 269
Query: 61 LIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLI 120
LIG STG+CEGGCAAIVDSGTSLLAGPTP++TEINHAIG EG+VSAECK VVS YGDLI
Sbjct: 270 LIGKHSTGLCEGGCAAIVDSGTSLLAGPTPIITEINHAIGAEGLVSAECKEVVSHYGDLI 329
Query: 121 WDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKEN---VSAGDSAVCSACEMAVV 177
W+L++SG+ P KVC Q+GLC FN A+ TGI++VVEKEN SAG+ C+AC+M V+
Sbjct: 330 WELIISGVQPSKVCTQLGLCIFNEAKSARTGIESVVEKENKEKSSAGNDLPCTACQMLVI 389
Query: 178 WVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPE 237
WVQNQL++K TKE ++Y+++LC+SLP+PMG+S IDC+ I TMPN++FTIGDK F+L+PE
Sbjct: 390 WVQNQLREKATKETAINYLDKLCESLPSPMGQSSIDCNSISTMPNITFTIGDKPFSLTPE 449
Query: 238 QYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 295
QYILKTGEGIA+VCISGFMA D+PPPRGPLWILGDVFMG YHT+FD G L +GFAEAA
Sbjct: 450 QYILKTGEGIAQVCISGFMALDVPPPRGPLWILGDVFMGAYHTIFDYGNLEVGFAEAA 507
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|171854659|dbj|BAG16519.1| putative aspartic protease [Capsicum chinense] | Back alignment and taxonomy information |
|---|
| >gi|294440430|gb|ADE74632.1| aspartic protease 1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|82623417|gb|ABB87123.1| aspartic protease precursor-like [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|418731269|gb|AFX67029.1| aspartic protease, partial [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|12231178|dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata] | Back alignment and taxonomy information |
|---|
| >gi|350535356|ref|NP_001234702.1| aspartic protease precursor [Solanum lycopersicum] gi|951449|gb|AAB18280.1| aspartic protease precursor [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|50540937|gb|AAT77954.1| Asp [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|357511707|ref|XP_003626142.1| Aspartic proteinase [Medicago truncatula] gi|355501157|gb|AES82360.1| Aspartic proteinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357511709|ref|XP_003626143.1| Aspartic proteinase [Medicago truncatula] gi|355501158|gb|AES82361.1| Aspartic proteinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 295 | ||||||
| TAIR|locus:2008940 | 506 | APA1 "aspartic proteinase A1" | 0.996 | 0.581 | 0.662 | 1.6e-111 | |
| UNIPROTKB|B9RXH6 | 511 | RCOM_0903730 "Aspartic protein | 1.0 | 0.577 | 0.664 | 4.2e-111 | |
| TAIR|locus:2018037 | 513 | AT1G62290 [Arabidopsis thalian | 0.996 | 0.573 | 0.636 | 5.7e-107 | |
| TAIR|locus:2137189 | 508 | AT4G04460 [Arabidopsis thalian | 1.0 | 0.580 | 0.589 | 1.7e-98 | |
| WB|WBGene00000217 | 444 | asp-4 [Caenorhabditis elegans | 0.359 | 0.238 | 0.5 | 1.9e-50 | |
| DICTYBASE|DDB_G0279411 | 383 | ctsD "cathepsin D" [Dictyostel | 0.372 | 0.287 | 0.478 | 2e-43 | |
| FB|FBgn0033933 | 404 | CG10104 [Drosophila melanogast | 0.335 | 0.245 | 0.444 | 1.4e-41 | |
| UNIPROTKB|P43159 | 396 | CTSE "Cathepsin E" [Oryctolagu | 0.369 | 0.275 | 0.433 | 6e-40 | |
| UNIPROTKB|F1NLA4 | 399 | LOC431167 "Uncharacterized pro | 0.294 | 0.218 | 0.448 | 5.3e-38 | |
| UNIPROTKB|E2RBZ3 | 359 | LOC611675 "Uncharacterized pro | 0.298 | 0.245 | 0.465 | 1.2e-35 |
| TAIR|locus:2008940 APA1 "aspartic proteinase A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1101 (392.6 bits), Expect = 1.6e-111, P = 1.6e-111
Identities = 198/299 (66%), Positives = 241/299 (80%)
Query: 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDI 60
M++QGL+ E VFSFWLNR+ D EEGGE+VFGGVDP HFKGKHTYVPVT+KGYWQF++GD+
Sbjct: 209 MLKQGLIKEPVFSFWLNRNADEEEGGELVFGGVDPNHFKGKHTYVPVTQKGYWQFDMGDV 268
Query: 61 LIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLI 120
LIG TG CE GC+AI DSGTSLLAGPT ++T INHAIG GVVS +CK VV QYG I
Sbjct: 269 LIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGVVSQQCKTVVDQYGQTI 328
Query: 121 WDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVS----AGDSAVCSACEMAV 176
DLL+S P+K+C QIGLC F+G VS GI++VV+KEN GD+A CSACEMAV
Sbjct: 329 LDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAA-CSACEMAV 387
Query: 177 VWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSP 236
VW+Q+QL+Q T+E++L+Y+NELC+ LP+PMGES +DC ++ TMP VS TIG K+F+L+P
Sbjct: 388 VWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDLAP 447
Query: 237 EQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 295
E+Y+LK GEG CISGF+A D+ PPRGPLWILGDVFMG YHTVFD G ++GFAEAA
Sbjct: 448 EEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEAA 506
|
|
| UNIPROTKB|B9RXH6 RCOM_0903730 "Aspartic proteinase, putative" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018037 AT1G62290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137189 AT4G04460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000217 asp-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279411 ctsD "cathepsin D" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033933 CG10104 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43159 CTSE "Cathepsin E" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLA4 LOC431167 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBZ3 LOC611675 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.23 | 0.766 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | estExt_fgenesh4_pm.C_LG_XIII0008 | hypothetical protein (507 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 295 | |||
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 3e-69 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 9e-53 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 1e-38 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 4e-38 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 5e-37 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 5e-34 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 1e-33 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 2e-33 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 1e-29 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 1e-27 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 2e-26 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 5e-26 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 2e-25 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 9e-25 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 3e-24 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 2e-22 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 2e-20 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 7e-18 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 2e-17 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 4e-15 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 6e-15 | |
| pfam03489 | 35 | pfam03489, SapB_2, Saposin-like type B, region 2 | 6e-11 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 1e-10 | |
| cd05473 | 364 | cd05473, beta_secretase_like, Beta-secretase, aspa | 1e-10 | |
| pfam05184 | 39 | pfam05184, SapB_1, Saposin-like type B, region 1 | 3e-10 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 4e-08 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 6e-08 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 4e-07 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 6e-07 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 4e-06 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 2e-04 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 2e-04 | |
| cd06096 | 326 | cd06096, Plasmepsin_5, Plasmepsins are a class of | 3e-04 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 6e-04 |
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
Score = 216 bits (553), Expect = 3e-69
Identities = 80/99 (80%), Positives = 90/99 (90%)
Query: 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDI 60
MVEQGLV E VFSFWLNR+PD EEGGE+VFGGVDPKHFKG+HTYVPVT+KGYWQFE+GD+
Sbjct: 138 MVEQGLVKEPVFSFWLNRNPDEEEGGELVFGGVDPKHFKGEHTYVPVTRKGYWQFEMGDV 197
Query: 61 LIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAI 99
LIG +STG C GGCAAI DSGTSLLAGPT +VT+IN A+
Sbjct: 198 LIGGKSTGFCAGGCAAIADSGTSLLAGPTTIVTQINSAV 236
|
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 317 |
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|112314 pfam03489, SapB_2, Saposin-like type B, region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >gnl|CDD|191220 pfam05184, SapB_1, Saposin-like type B, region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133160 cd06096, Plasmepsin_5, Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 295 | |||
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 100.0 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 100.0 | |
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 100.0 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 100.0 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 100.0 | |
| PTZ00165 | 482 | aspartyl protease; Provisional | 100.0 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 100.0 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 100.0 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 100.0 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 99.98 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 99.97 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 99.97 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 99.97 | |
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 99.95 | |
| cd05473 | 364 | beta_secretase_like Beta-secretase, aspartic-acid | 99.95 | |
| cd06097 | 278 | Aspergillopepsin_like Aspergillopepsin_like, aspar | 99.94 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 99.94 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 99.94 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 99.93 | |
| KOG1339 | 398 | consensus Aspartyl protease [Posttranslational mod | 99.93 | |
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 99.92 | |
| cd05471 | 283 | pepsin_like Pepsin-like aspartic proteases, biloba | 99.91 | |
| PLN03146 | 431 | aspartyl protease family protein; Provisional | 99.88 | |
| PF14541 | 161 | TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D | 99.75 | |
| PF03489 | 35 | SapB_2: Saposin-like type B, region 2; InterPro: I | 98.62 | |
| KOG1340 | 218 | consensus Prosaposin [Lipid transport and metaboli | 98.58 | |
| PF05184 | 39 | SapB_1: Saposin-like type B, region 1; InterPro: I | 98.27 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 97.19 | |
| KOG1340 | 218 | consensus Prosaposin [Lipid transport and metaboli | 96.37 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 95.15 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 93.67 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 91.65 | |
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 91.13 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 85.1 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 84.92 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 83.91 | |
| COG3577 | 215 | Predicted aspartyl protease [General function pred | 83.43 | |
| PF13975 | 72 | gag-asp_proteas: gag-polyprotein putative aspartyl | 80.18 |
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.1e-36 Score=278.95 Aligned_cols=190 Identities=45% Similarity=0.913 Sum_probs=164.3
Q ss_pred CccCCCCCCCeEEEEeecCCCCCCCcEEEECCcCCCCeeeceEEEEccccceEEEEEceEEECCeeecccCCCceEEecc
Q 022584 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDS 80 (295)
Q Consensus 1 l~~qg~i~~~~Fs~~l~~~~~~~~~G~l~~Gg~d~~~~~g~l~~~p~~~~~~w~v~~~~i~v~~~~~~~~~~~~~~ivDT 80 (295)
|++||+|++++||+||++++++...|+|+|||+|++++.|++.|+|+.+.++|.|+++++.|+++.+. +..+..++|||
T Consensus 127 l~~qg~i~~~~FS~~L~~~~~~~~~g~l~fGg~d~~~~~g~l~~~pi~~~~~w~v~l~~i~v~g~~~~-~~~~~~aiiDT 205 (316)
T cd05486 127 MMAQNLVELPMFSVYMSRNPNSADGGELVFGGFDTSRFSGQLNWVPVTVQGYWQIQLDNIQVGGTVIF-CSDGCQAIVDT 205 (316)
T ss_pred HHhcCCCCCCEEEEEEccCCCCCCCcEEEEcccCHHHcccceEEEECCCceEEEEEeeEEEEecceEe-cCCCCEEEECC
Confidence 57899999999999999865544579999999999999999999999999999999999999998764 23467899999
Q ss_pred cccccccChHHHHHHHHHhcCCCcchhhhHHHHHhhHHHHHHHHHhCCChhhhhhhcccCcCCCcccccccceeeeeccc
Q 022584 81 GTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKEN 160 (295)
Q Consensus 81 Gtt~i~lp~~~~~~l~~~i~~~~~~~~~c~~~v~~y~~~i~~~l~~~~~p~~vc~~~~~c~~~~~~~~~~~~~~~~~~~~ 160 (295)
||+++++|+++++++.+.+++.
T Consensus 206 GTs~~~lP~~~~~~l~~~~~~~---------------------------------------------------------- 227 (316)
T cd05486 206 GTSLITGPSGDIKQLQNYIGAT---------------------------------------------------------- 227 (316)
T ss_pred CcchhhcCHHHHHHHHHHhCCc----------------------------------------------------------
Confidence 9999999999999988777543
Q ss_pred ccCCCCccchhhHHHHHHHHHHhhchhhHHHHHHHHHhhcccCCCCCCceEEecccCCCCCcEEEEECCEEEEECcccce
Q 022584 161 VSAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYI 240 (295)
Q Consensus 161 ~~~~~~~~c~~c~~~~~~~~~~l~~~~~~~~i~~~l~~~C~~~~~~~g~~~~~C~~~~~lp~i~f~~~g~~~~i~p~~y~ 240 (295)
...+.|.++|+....+|+|+|+|+|+.++|+|++|+
T Consensus 228 --------------------------------------------~~~~~~~~~C~~~~~~p~i~f~f~g~~~~l~~~~y~ 263 (316)
T cd05486 228 --------------------------------------------ATDGEYGVDCSTLSLMPSVTFTINGIPYSLSPQAYT 263 (316)
T ss_pred --------------------------------------------ccCCcEEEeccccccCCCEEEEECCEEEEeCHHHeE
Confidence 013458899998888999999999999999999999
Q ss_pred EEeccccccceeeeEEEccCCCCCCCceEEchhhhccceEEEeCCCCeEEeee
Q 022584 241 LKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAE 293 (295)
Q Consensus 241 ~~~~~~~~~~C~~~~~~~~~~~~~~~~~IlG~~fl~~~yvvFD~~~~rIGfa~ 293 (295)
+.....+.+.|+++|+..+..+..++.||||+.|||++|+|||.+++|||||+
T Consensus 264 ~~~~~~~~~~C~~~~~~~~~~~~~~~~~ILGd~flr~~y~vfD~~~~~IGfA~ 316 (316)
T cd05486 264 LEDQSDGGGYCSSGFQGLDIPPPAGPLWILGDVFIRQYYSVFDRGNNRVGFAP 316 (316)
T ss_pred EecccCCCCEEeeEEEECCCCCCCCCeEEEchHHhcceEEEEeCCCCEeeccC
Confidence 87533345789999988765545567899999999999999999999999996
|
Cathepsin E is an intracellular, non-lysosomal aspartic protease expressed in a variety of cells and tissues. The protease has proposed physiological roles in antigen presentation by the MHC class II system, in the biogenesis of the vasoconstrictor peptide endothelin, and in neurodegeneration associated with brain ischemia and aging. Cathepsin E is the only A1 aspartic protease that exists as a homodimer with a disulfide bridge linking the two monomers. Like many other aspartic proteases, it is synthesized as a zymogen which is catalytically inactive towards its natural substrates at neutral pH and which auto-activates in an acidic environment. The overall structure follows the general fold of aspartic proteases of the A1 family, it is composed of two structurally similar beta barrel lobes, each lobe contributing an aspartic acid residue to form a catalytic dyad that acts to cleave the substrate peptide bond. The catalyt |
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >KOG1339 consensus Aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >PLN03146 aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >PF14541 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 3HD8_A 1T6G_A 1T6E_X 2B42_A 3VLB_A 3VLA_A | Back alignment and domain information |
|---|
| >PF03489 SapB_2: Saposin-like type B, region 2; InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes [] | Back alignment and domain information |
|---|
| >KOG1340 consensus Prosaposin [Lipid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF05184 SapB_1: Saposin-like type B, region 1; InterPro: IPR007856 Synonym(s):cerebroside sulphate activator, CSAct Saposin B is a small non-enzymatic glycoprotein required for the breakdown of cerebroside sulphates (sulphatides) in lysosomes | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
| >KOG1340 consensus Prosaposin [Lipid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >COG3577 Predicted aspartyl protease [General function prediction only] | Back alignment and domain information |
|---|
| >PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 295 | ||||
| 1qdm_A | 478 | Crystal Structure Of Prophytepsin, A Zymogen Of A B | 1e-111 | ||
| 1b5f_A | 239 | Native Cardosin A From Cynara Cardunculus L. Length | 2e-38 | ||
| 3rfi_A | 108 | Crystal Structure Of The Saposin-Like Domain Of Pla | 2e-33 | ||
| 1b5f_B | 87 | Native Cardosin A From Cynara Cardunculus L. Length | 2e-25 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 5e-25 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 8e-20 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 2e-16 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 4e-19 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 4e-14 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 4e-19 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 5e-14 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 4e-19 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 4e-14 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 4e-19 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 4e-14 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 4e-19 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 4e-14 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 4e-19 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 4e-14 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 2e-18 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 5e-14 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 7e-18 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 2e-15 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 8e-18 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 2e-15 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 8e-18 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 3e-15 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 8e-18 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 4e-15 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 9e-18 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 4e-15 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 9e-18 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 3e-15 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 1e-17 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 3e-15 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 5e-17 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 4e-13 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 5e-17 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 1e-13 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 5e-17 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 3e-11 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 1e-16 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 2e-16 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 5e-15 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 2e-09 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 1e-14 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 9e-10 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 1e-14 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 9e-10 | ||
| 3oad_B | 176 | Design And Optimization Of New Piperidines As Renin | 3e-14 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 1e-13 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 6e-11 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 2e-13 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 9e-10 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 2e-13 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 1e-09 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 2e-13 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-09 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 5e-13 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 2e-07 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 5e-13 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 2e-07 | ||
| 2ewy_A | 383 | Crystal Structure Of Human Bace2 In Complex With A | 2e-07 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 2e-06 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 3e-05 | ||
| 1eag_A | 342 | Secreted Aspartic Proteinase (Sap2) From Candida Al | 4e-06 | ||
| 2h6s_A | 340 | Secreted Aspartic Proteinase (sap) 3 From Candida A | 7e-06 | ||
| 1zap_A | 342 | Secreted Aspartic Protease From C. Albicans Length | 1e-05 | ||
| 1j71_A | 334 | Structure Of The Extracellular Aspartic Proteinase | 5e-05 | ||
| 2qzx_A | 342 | Secreted Aspartic Proteinase (Sap) 5 From Candida A | 6e-05 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 9e-05 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 9e-05 | ||
| 3fv3_A | 339 | Secreted Aspartic Protease 1 From Candida Parapsilo | 9e-05 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 1e-04 | ||
| 2qzw_A | 341 | Secreted Aspartic Proteinase (Sap) 1 From Candida A | 1e-04 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 1e-04 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 3e-04 | ||
| 1uh7_A | 325 | Crystal Structure Of Rhizopuspepsin At Ph 4.6 Lengt | 2e-04 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 2e-04 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 2e-04 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 2e-04 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 2e-04 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 2e-04 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 2e-04 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 2e-04 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 2e-04 |
| >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. Length = 478 | Back alignment and structure |
|
| >pdb|1B5F|A Chain A, Native Cardosin A From Cynara Cardunculus L. Length = 239 | Back alignment and structure |
| >pdb|3RFI|A Chain A, Crystal Structure Of The Saposin-Like Domain Of Plant Aspartic Protease From Solanum Tuberosum Length = 108 | Back alignment and structure |
| >pdb|1B5F|B Chain B, Native Cardosin A From Cynara Cardunculus L. Length = 87 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|3OAD|B Chain B, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 176 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|2EWY|A Chain A, Crystal Structure Of Human Bace2 In Complex With A Hydroxyethylenamine Transition-State Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap2) From Candida Albicans Complexed With A70450 Length = 342 | Back alignment and structure |
| >pdb|2H6S|A Chain A, Secreted Aspartic Proteinase (sap) 3 From Candida Albicans Length = 340 | Back alignment and structure |
| >pdb|1ZAP|A Chain A, Secreted Aspartic Protease From C. Albicans Length = 342 | Back alignment and structure |
| >pdb|1J71|A Chain A, Structure Of The Extracellular Aspartic Proteinase From Candida Tropicalis Yeast Length = 334 | Back alignment and structure |
| >pdb|2QZX|A Chain A, Secreted Aspartic Proteinase (Sap) 5 From Candida Albicans Length = 342 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|3FV3|A Chain A, Secreted Aspartic Protease 1 From Candida Parapsilosis In Complex With Pepstatin A Length = 339 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|2QZW|A Chain A, Secreted Aspartic Proteinase (Sap) 1 From Candida Albicans Length = 341 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspepsin At Ph 4.6 Length = 325 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
Score = 357 bits (918), Expect = e-122
Identities = 192/298 (64%), Positives = 236/298 (79%), Gaps = 3/298 (1%)
Query: 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDI 60
M+EQGLVS+ VFSFWLNR D EGGEI+FGG+DPKH+ G+HTYVPVT+KGYWQF++GD+
Sbjct: 181 MIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKGYWQFDMGDV 240
Query: 61 LIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLI 120
L+G +STG C GGCAAI DSGTSLLAGPT ++TEIN IG GVVS ECK +VSQYG I
Sbjct: 241 LVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQECKTIVSQYGQQI 300
Query: 121 WDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEK---ENVSAGDSAVCSACEMAVV 177
DLL++ P+K+C Q+GLC F+G VS GI++VV+ ++ +CSACEMAVV
Sbjct: 301 LDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRADPMCSACEMAVV 360
Query: 178 WVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPE 237
W+QNQL Q +T++ +L Y+N+LC+ LP+PMGES +DC + +MP++ FTIG K F L PE
Sbjct: 361 WMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKKFALKPE 420
Query: 238 QYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 295
+YILK GEG A CISGF A D+PPPRGPLWILGDVFMG YHTVFD GKLRIGFA+AA
Sbjct: 421 EYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGFAKAA 478
|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 87 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} Length = 108 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 Length = 78 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 Length = 81 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 295 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 100.0 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 100.0 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 100.0 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 100.0 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 100.0 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 100.0 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 100.0 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 100.0 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 100.0 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 100.0 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 100.0 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 100.0 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 100.0 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 100.0 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 100.0 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 100.0 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 100.0 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 100.0 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 100.0 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 100.0 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 100.0 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 100.0 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 99.98 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 99.98 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 99.98 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 99.98 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 99.98 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 99.96 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 99.96 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 99.96 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 99.96 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 99.96 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 99.96 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 99.96 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 99.86 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 99.86 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 99.76 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 98.5 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 98.42 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 98.35 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 98.29 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 98.21 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 98.08 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 98.08 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 98.07 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 97.85 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 97.83 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 97.82 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 97.79 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 97.78 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 97.73 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 97.71 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 97.69 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 97.55 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 97.48 | |
| 3s64_A | 87 | AC-SLP-1, saposin-like protein 1; lipid-binding, l | 97.46 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 91.61 | |
| 3s64_A | 87 | AC-SLP-1, saposin-like protein 1; lipid-binding, l | 85.78 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-57 Score=447.25 Aligned_cols=295 Identities=65% Similarity=1.214 Sum_probs=252.1
Q ss_pred CccCCCCCCCeEEEEeecCCCCCCCcEEEECCcCCCCeeeceEEEEccccceEEEEEceEEECCeeecccCCCceEEecc
Q 022584 1 MVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDS 80 (295)
Q Consensus 1 l~~qg~i~~~~Fs~~l~~~~~~~~~G~l~~Gg~d~~~~~g~l~~~p~~~~~~w~v~~~~i~v~~~~~~~~~~~~~~ivDT 80 (295)
|++||+|++++||+||+++.+...+|.|+|||+|++++.|++.|+|+.+.++|.|++++|.|+++.+.++..++.+++||
T Consensus 181 l~~qg~i~~~~FS~~L~~~~~~~~~G~l~fGg~d~~~~~G~l~~~pv~~~~~w~v~l~~i~v~g~~~~~~~~~~~aiiDT 260 (478)
T 1qdm_A 181 MIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADS 260 (478)
T ss_dssp HTTTTCCSSSEEEEECCCC-----CEEEEETCCCTTSEEEEEEEEEEEEETTEEEEECCEEETTEECSTTTTCEEEEECS
T ss_pred HHHCCCCCCCEEEEEeecCCCCCCCeEEEeCCcCHhhcCCCceEEeccCCCeEEEEEeEEEECCEEEeecCCCceEEEcC
Confidence 57899999999999999875444589999999999999999999999989999999999999999887666788999999
Q ss_pred cccccccChHHHHHHHHHhcCCCcchhhhHHHHHhhHHHHHHHHHhCCChhhhhhhcccCcCCCcccccccceeeeeccc
Q 022584 81 GTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKEN 160 (295)
Q Consensus 81 Gtt~i~lp~~~~~~l~~~i~~~~~~~~~c~~~v~~y~~~i~~~l~~~~~p~~vc~~~~~c~~~~~~~~~~~~~~~~~~~~ 160 (295)
||+++++|.+++++|.+++++...++.+|+.+|++|++.|+++|++.++|.+||.++|+|...+.+....+++.++++++
T Consensus 261 GTs~~~lP~~~~~~i~~~i~a~~~~s~~Ck~~v~~yg~~ii~~l~~~~~p~~vC~~iglC~~~~~~~~~~~~~~v~~~~~ 340 (478)
T 1qdm_A 261 GTSLLAGPTAIITEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEP 340 (478)
T ss_dssp SCCSEEECHHHHHHHHHHHTCCCBCCHHHHHHHHHTHHHHHHHHHTTCCHHHHHHHTTCC--------------------
T ss_pred CCCceeCCHHHHHHHHHHhCccccccccccchhhhhhhHHHHhhhhccChhhhhccccccccCccccccccccccccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999988777777777777642
Q ss_pred ---ccCCCCccchhhHHHHHHHHHHhhchhhHHHHHHHHHhhcccCCCCCCceEEecccCCCCCcEEEEECCEEEEECcc
Q 022584 161 ---VSAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPE 237 (295)
Q Consensus 161 ---~~~~~~~~c~~c~~~~~~~~~~l~~~~~~~~i~~~l~~~C~~~~~~~g~~~~~C~~~~~lp~i~f~~~g~~~~i~p~ 237 (295)
....+...|.+|||++.|+++.|++|+|+++|.+.+++.|+.++...|.|.++|+.+..+|+|+|+|+|+.++|+|+
T Consensus 341 ~~~~~~~~~~~C~~Ce~~v~~~~~~l~~n~t~~~I~~~~~~~C~~~~~~~g~~~v~C~~~~~lP~i~f~~gg~~~~l~p~ 420 (478)
T 1qdm_A 341 VKSNGLRADPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKKFALKPE 420 (478)
T ss_dssp -------CHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHTTCBCCSSSCCEECGGGGTTCCCEEEEETTEEEEECHH
T ss_pred cccccccccccchHHHHHHHHHHHHHhccccHHHHHHHHHHHhhccCCCCCeEEeecccccccccEEEEECCEEEEEChH
Confidence 33455788999999999999999999999999999999999999999999999998889999999999999999999
Q ss_pred cceEEeccccccceeeeEEEccCCCCCCCceEEchhhhccceEEEeCCCCeEEeeecC
Q 022584 238 QYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 295 (295)
Q Consensus 238 ~y~~~~~~~~~~~C~~~~~~~~~~~~~~~~~IlG~~fl~~~yvvFD~~~~rIGfa~~~ 295 (295)
+|+++...+....|+++|.+++.+++.++.||||++|||++|+|||++++|||||+++
T Consensus 421 ~yi~~~~~~~~~~C~~~~~~~~~~~~~~~~~ILGd~fl~~~y~vfD~~~~rIGfA~a~ 478 (478)
T 1qdm_A 421 EYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGFAKAA 478 (478)
T ss_dssp HHEEECSCGGGCCEEESEEECCCCTTSCSEEEECHHHHTTEEEEEETTTTEEEEEEEC
T ss_pred HhEEEccCCCCCeEEEEEEeccCCCCCCCcEEECHHHhccEEEEEECCCCEEEEEeCC
Confidence 9999866545678999999888766667899999999999999999999999999986
|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >3s64_A AC-SLP-1, saposin-like protein 1; lipid-binding, lipid binding protein; HET: CIT EPE; 2.30A {Ancylostoma caninum} | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s64_A AC-SLP-1, saposin-like protein 1; lipid-binding, lipid binding protein; HET: CIT EPE; 2.30A {Ancylostoma caninum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 295 | ||||
| d1qdma1 | 104 | a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Horde | 7e-35 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 6e-30 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 3e-18 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 1e-28 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 2e-16 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 9e-28 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 3e-18 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 3e-27 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 5e-16 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 7e-27 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 7e-16 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 2e-26 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 8e-20 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 2e-26 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 3e-19 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 6e-25 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 2e-17 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 3e-24 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 1e-11 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 3e-24 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 1e-15 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 2e-22 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 5e-12 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 9e-21 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 4e-15 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 2e-20 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 6e-15 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 8e-20 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 1e-12 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 5e-19 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 7e-09 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 5e-18 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 3e-13 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 6e-18 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 4e-08 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 7e-17 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 7e-16 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 1e-16 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 1e-14 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 2e-16 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 2e-11 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 2e-16 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 5e-15 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 4e-16 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 6e-15 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 3e-12 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 0.002 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 9e-12 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 1e-08 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 5e-11 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 2e-05 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 7e-07 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 6e-04 | |
| d1l9la_ | 74 | a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Hom | 5e-06 |
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 104 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Saposin-like superfamily: Saposin family: Swaposin domain: (Pro)phytepsin species: Barley (Hordeum vulgare) [TaxId: 4513]
Score = 120 bits (301), Expect = 7e-35
Identities = 55/104 (52%), Positives = 75/104 (72%), Gaps = 3/104 (2%)
Query: 104 VVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSA 163
VVS ECK +VSQYG I DLL++ P+K+C Q+GLC F+G VS GI++VV+ E V +
Sbjct: 1 VVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKS 60
Query: 164 ---GDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLP 204
+CSACEMAVVW+QNQL Q +T++ +L Y+N+LC+ LP
Sbjct: 61 NGLRADPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLP 104
|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 295 | |||
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 100.0 | |
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 100.0 | |
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 100.0 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 100.0 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 100.0 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 99.97 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 99.97 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 99.97 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 99.97 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 99.97 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 99.97 | |
| d1eaga_ | 342 | Acid protease {Yeast (Candida albicans) [TaxId: 54 | 99.97 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 99.97 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 99.96 | |
| d1mppa_ | 357 | Pepsin {Mucor pusillus [TaxId: 4840]} | 99.96 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 99.96 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 99.96 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 99.95 | |
| d2qp8a1 | 387 | beta-secretase (memapsin) {Human (Homo sapiens) [T | 99.92 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 99.89 | |
| d1qdma1 | 104 | (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4 | 99.76 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 98.22 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 98.06 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 97.78 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 97.45 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 97.44 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 97.41 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 97.25 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 97.1 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 96.97 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 87.06 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 85.47 |
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|