Citrus Sinensis ID: 022663

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----

MADGMNENEKLNSIKVCGMQFSYEGNDKPPLFYDFNLGISPGSRCLLVGANGSGKTTLLKILAGKHMVGGRDVVQVLNRSSFHDTQLVCSGDLSYLGGSWSKTVGSAGEIPLQGDFSAEHMIFGVEGSDPVRRERLIELLDIDLQWRMHKVSDGQRRRVQICMGLLHPFKVLLLDEITVDLDVVARMDLLDFFKDECEQRGATIVYATHIFDGLETWATHLAYIQDGELRRAEKLAELDELRNSTNLLSVVESWLRSETKLEKKRPVDPPKQVQKTSPFGSSPFMSSRHMAYNR

cccccccccccccEEEcccEEEcccccccccEEccEEEEccccEEEEEccccccHHHHHHHHHccEEEccccEEEEccccccccccccccccccCEEEEEEcccccccccccccccHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHccEEEEEEccEEEEcccHHHHHHHHcccEEEEEEEccccHHHHHccccccccccccccccccccccccccccccccc

*************IKVCGMQFSYEGNDKPPLFYDFNLGISPGSRCLLVGANGSGKTTLLKILAGKHMVGGRDVVQVLNRSSFHDTQLVCSGDLSYLGGSWSKTVGSAGEIPLQGDFSAEHMIFGVEGSDPVRRERLIELLDIDLQWRMHKVSDGQRRRVQICMGLLHPFKVLLLDEITVDLDVVARMDLLDFFKDECEQRGATIVYATHIFDGLETWATHLAYIQDGELRRAEKLAELDELRNSTNLLSVVESWLRS**************************FMSSR*MAYNR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MADGMNENEKLNSIKVCGMQFSYEGNDKPPLFYDFNLGISPGSRCLLVGANGSGKTTLLKILAGKHMVGGRDVVQVLNRSSFHDTQLVCSGDLSYLGGSWSKTVGSAGEIPLQGDFSAEHMIFGVEGSDPVRRERLIELLDIDLQWRMHKVSDGQRRRVQICMGLLHPFKVLLLDEITVDLDVVARMDLLDFFKDECEQRGATIVYATHIFDGLETWATHLAYxxxxxxxxxxxxxxxxxxxxxTNLLSVVESWLRSETKLEKKRPVDPPKQVQKTSPFGSSPFMSSRHMAYNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ABC transporter I family member 19		confident	Q3EDJ0
ABC transporter I family member 21		probable	Q9XF19
Uncharacterized ABC transporter ATP-binding protein C20G4.01		probable	Q7Z991

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 11-232
View the alignment between query and template
View the model in PyMOL

Template: 4FWI, chain B
Confidence level:probable
Coverage over the Query: 35-255,266-277
View the alignment between query and template
View the model in PyMOL