Citrus Sinensis ID: 022694


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MFTNRYLQDAFKVPLVIQLTDDEKCMWKNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVGIFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDHLRCLIPCAIDQDPYFRMTRDVAPRIGYHKPALIESSFFPALQGETGKMSASDPNSAIYVTDSAKAIKNKINKYAFSGGQESVELHRKLGANLEVDIPVKYLSFFLEDDAELEHIKKEYGAGGMLTGEVKQRLAKVLTELVERHQVARAAVTDEMVDAFMAVRPLPNMFD
ccHHHHHHHcccccEEEEECcccHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEEECcccccHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEEcccHHHHHHHHHHcccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccc
MFTNRYLQDAFKVPLVIQLTDDEKCMWKNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVGIFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDHLRCLIPCAIDQDPYFRMTRDVAPRIGYHKPALIESSFFPAL**************AIYVTDSAKAIKNKINKYAFSGGQESVELHRKLGANLEVDIPVKYLSFFLEDDAELEHIKKEYGAGGMLTGEVKQRLAKVLTELVERHQVARAAVTDEMVDAFMAVRPLP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTNRYLQDAFKVPLVIQLTDDEKCMWKNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVGIFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDHLRCLIPCAIDQDPYFRMTRDVAPRIGYHKPALIESSFFPALQGETGKMSASDPNSAIYVTDSAKAIKNKINKYAFSGGQESVELHRKLGANLEVDIPVKYLSFFLEDDAELEHIKKEYGAGGMLTGEVKQRLAKVLTELVERHQVARAAVTDEMVDAFMAVRPLPNMFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tryptophan--tRNA ligase, cytoplasmic probableQ12109
Tryptophan--tRNA ligase, cytoplasmic Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.probableP23381
Tryptophan--tRNA ligase, cytoplasmic T1-TrpRS has aminoacylation activity while T2-TrpRS lacks it. T1-TrpRS and T2-TrpRS possess angiostatic activity. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.probableQ5R4J1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.2Tryptophan--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R6T, chain A
Confidence level:very confident
Coverage over the Query: 2-289
View the alignment between query and template
View the model in PyMOL