Citrus Sinensis ID: 022717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MTTLSSLREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI
cEEEccccccHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEcccCEEcccccccccccHHHHcccccccccEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccc
MTTLSSLREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQD*P*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLSSLREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). Required for the production of the monomethyl branched-chain fatty acids (mmBCFAs) isopentadecanoate (C15iso) and isoheptadecanoate (C17iso).probableO45924

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BFD, chain A
Confidence level:very confident
Coverage over the Query: 2-183,205-292
View the alignment between query and template
View the model in PyMOL