Citrus Sinensis ID: 022723


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MLRRNIRLRREYLYRKSLEGKERLLYEKKRKIKEALQEGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRGGQVISEIIETCRAHEFTDVVLVHEHRGVPDGLIICHLPFGPTAYFGLLNVVTRHDIKDRKSIGTMPEAYPHLILDNFKSKLGERTANILKHLFPVPKADTKRIITFANQSDYISFRHHIYEKQGGPKSLELKEIGPRFELRLYQIKLGTVDQSEAQIEWVIRPYMNTSKKRKFLGD
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccHHHcccccccccEEEEEcccccHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHcccccEEEEEECcccccEEEEEEcccccEEEEEEEEEEEccccccccccccccccccEEEEcccccccHHHHHHHHHHHcccccccccEEEEEEEcccEEEEEEEEEEECcccccccEEEcccccEEEEEEEccccccccccEEEEEEccccccccccccccc
**R***RLRREYLYR*****************************************IDLEDENTAIPR***********ERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRGGQVISEIIETCRAHEFTDVVLVHEHRGVPDGLIICHLPFGPTAYFGLLNVVTRHDIKDRKSIGTMPEAYPHLILDNFKSKLGERTANILKHLFPVPKADTKRIITFANQSDYISFRHHIYEKQGGPKSLELKEIGPRFELRLYQIKLGTVDQSEAQIEWVIRPYMNTSK**KFL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRRNIRLRREYLYRKSxxxxxxxxxxxxxxxxxxxxxGKPIPTELRNEEAALRQEIDLEDENTAIPRSHIDDEYANATERDPKILLTTSRDPSAPLTQFVKELKFVFPNAQRMNRGGQVISEIIETCRAHEFTDVVLVHEHRGVPDGLIICHLPFGPTAYFGLLNVVTRHDIKDRKSIGTMPEAYPHLILDNFKSKLGERTANILKHLFPVPKADTKRIITFANQSDYISFRHHIYEKQGGPKSLELKEIGPRFELRLYQIKLGTVDQSEAQIEWVIRPYMNTSKKRKFLGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U3 small nucleolar ribonucleoprotein protein IMP4 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.probableQ0VD01
U3 small nucleolar ribonucleoprotein protein IMP4 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.probableQ8VHZ7
U3 small nucleolar ribonucleoprotein protein IMP4 Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.probableQ5R947

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CXH, chain A
Confidence level:very confident
Coverage over the Query: 82-258
View the alignment between query and template
View the model in PyMOL