Citrus Sinensis ID: 022821

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MAKMSLIFSLFVGLLMVVLVSSAKFDDLYQTSWAFDHVQYDGDTLKLNLDNYSGAGFASKSKYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGVGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAMGVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACECPASVAGADNAKKCSSSAEKRFWWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFPAIPTECVHHRH
cccHHHHHHHHHHHHHHHHccccccccccccccccccEECcccEEEEEEEccccccCECccCEEEEEEEEEEEECcccccccEEEEEEcccccccccEEEEcccccccccEEEEEEEEEcccccCEEEEEcccccccccEEEEEEEEccEEEEEEccCEEEEECcccccccccccccccEEEEEECccccccccccCEEcccccccEEEEEEEEEEECcccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEcccccccccccccccccccc
****SLIFSLFVGLLMVVLVSSAKFDDLYQTSWAFDHVQYDGDTLKLNLDNYSGAGFASKSKYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGVGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAMGVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACECPASVA***************FWWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFPAIPTEC*****
xxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKMSLIFSLFVGLLMVVLVSSAKFDDLYQTSWAFDHVQYDGDTLKLNLDNYSGAGFASKSKYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGVGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAMGVYSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACECPASVAGADNAKKCSSSAEKRFWWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFPAIPTECVHHRH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Xyloglucan endotransglucosylase/hydrolase protein 9 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. Involved in internodal cell elongation.confidentQ8LDW9
Xyloglucan endotransglucosylase/hydrolase protein A Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ41638
Xyloglucan endotransglucosylase/hydrolase Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ6YDN9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.207Xyloglucan:xyloglucosyl transferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 21-289
View the alignment between query and template
View the model in PyMOL