Citrus Sinensis ID: 022844


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MTIHSSKHQDDVDKNARSSYFNLPALDISVAFPQATPASKFPPCASDYYQFDDLLTSEEQAVRMKVRECMEKEIAPIMAEYWEKAEFPFHVIPKLGALRVAGGTIKGYGCPGHSVTGAAIAIAEIARVDASCSTFILVHSSLAMLTIALCGSEEQKQKYLPSLAQLNTIACWALTEPAYGSDASALNTTATKVEGGWILEGQKRWIGNSTFADVLVIFARNTTTNQINGYLVKKDAPGLTVTKIENKIGLRIVQNGDILLKKVFVPDEDRLPGVNSFQDTSKVRLLCSKFL
cccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHcccccccccEEEEEEccccccccccccccCEEEECccEEEEcccEEEEEccccccEEEEEEEEcccccEEEEEEcccccccccccccccEEEEEECcccEEEcccccccccccccccccHHHHHHHHHHcccc
*******************YFNLPALDISVAFPQATPASKFPPCASDYYQFDDLLTSEEQAVRMKVRECMEKEIAPIMAEYWEKAEFPFHVIPKLGALRVAGGTIKGYGCPGHSVTGAAIAIAEIARVDASCSTFILVHSSLAMLTIALCGSEEQKQKYLPSLAQLNTIACWALTEPAYGSDASALNTTATKVEGGWILEGQKRWIGNSTFADVLVIFARNTTTNQINGYLVKKDAPGLTVTKIENKIGLRIVQNGDILLKKVFVPDEDRLPGVNSFQDTSKVRLLCSKF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIHSSKHQDDVDKNARSSYFNLPALDISVAFPQATPASKFPPCASDYYQFDDLLTSEEQAVRMKVRECMEKEIAPIMAEYWEKAEFPFHVIPKLGALRVAGGTIKGYGCPGHSVTGAAIAIAEIARVDASCSTFILVHSSLAMLTIALCGSEEQKQKYLPSLAQLNTIACWALTEPAYGSDASALNTTATKVEGGWILEGQKRWIGNSTFADVLVIFARNTTTNQINGYLVKKDAPGLTVTKIENKIGLRIVQNGDILLKKVFVPDEDRLPGVNSFQDTSKVRLLCSKFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-coenzyme A oxidase 4, peroxisomal Catalyzes the desaturation of short-chain acyl-CoAs to 2-trans-enoyl-CoAs. Active on butyryl-CoA (C4), hexanoyl-CoA (C6), and octanoyl-CoA (C8). Has no activity as acyl-CoA dehydrogenase or on crotonyl-CoA (an unsaturated C4:1 carbocyclic ester) or glutaryl-CoA (a dicarboxylic ester).probableQ96329

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IX5, chain A
Confidence level:very confident
Coverage over the Query: 17-289
View the alignment between query and template
View the model in PyMOL