Citrus Sinensis ID: 022859

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MEKIRRASHAGSWYTDNSKRLAEELDGWLREAGLPKSPEVRGVIAPHAGYSYSGRAAAYAFGNIDPTSISRVFLLGPSHHYYTPKCALSTATVYKTPIGDLPLDLEVIEELKATGKFELMDICVDEAEHSMEMHLPYLAKVFEGHLIKIVPILVGAVNAENEAMYGRLFAKYVDDPSNFFSVSSDFCHWGSRFNYMHYDKKHGVIHKSIEALDKMGMDIIETGDPDAFKKYLLEYDNTICGRHPISVFLHMLGNCSTKIKIKFLRYEQSSQCKTKRDSSVSYASAAAKVDA
cccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHccccEEcccccccccccccccHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHccccCEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccEEcccHHHHHHHHHHHcccccEEEEEEccccccccccccccEEEEEEEEEEcc
************WYTDNSKRLAEELDGWLREAGL***PEVRGVIAPHAGYSYSGRAAAYAFGNIDPTSISRVFLLGPSHHYYTPKCALSTATVYKTPIGDLPLDLEVIEELKATGKFELMDICVDEAEHSMEMHLPYLAKVFEGHLIKIVPILVGAVNAENEAMYGRLFAKYVDDPSNFFSVSSDFCHWGSRFNYMHYDKKHGVIHKSIEALDKMGMDIIETGDPDAFKKYLLEYDNTICGRHPISVFLHMLGNCSTKIKIKFLRYEQSSQCKTKRDSSVSYASAAAKVDA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKIRRASHAGSWYTDNSKRLAEELDGWLREAGLPKSPEVRGVIAPHAGYSYSGRAAAYAFGNIDPTSISRVFLLGPSHHYYTPKCALSTATVYKTPIGDLPLDLEVIEELKATGKFELMDICVDEAEHSMEMHLPYLAKVFEGHLIKIVPILVGAVNAENEAMYGRLFAKYVDDPSNFFSVSSDFCHWGSRFNYMHYDKKHGVIHKSIEALDKMGMDIIETGDPDAFKKYLLEYDNTICGRHPISVFLHMLGNCSTKIKIKFLRYEQSSQCKTKRDSSVSYASAAAKVDA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein MEMO1 May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling.probableQ6DJ03
Protein MEMO1 May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.probableQ2HJH7
Protein MEMO1 May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling.probableQ803S3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BCZ, chain A
Confidence level:very confident
Coverage over the Query: 3-289
View the alignment between query and template
View the model in PyMOL