Citrus Sinensis ID: 022862

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-

MATTKTKTTSTTSLLLLFSFIIVFLSIPSFSSSSSSTDSFVFGGCAQQKYTPSSAYESNLNSLLTSLVNSATYSSYNNFTIMGSSPQDVVYGLYQCRGDLSMPDCATCVARAVTQVGGLCYQDCGGALQLQGCYVKYDNATFLGVEDKTVVFKKCGPSVGYEPDAMGRRDAVLQGLMTASGPYRVGGARDVQGLAQCVGDLSAGECQDCLVQAIGRLKSDCGTADYGDMFLGKCYVRYSTGKAPNSYKDHNDKSSNEGEKTFAIIVGLLAGVALIIIFLTFIRKVFGEHGK

ccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccCEEECcccccccEEEEEEccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccEEEEccccccccccccCEEECccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccEEECccEEEEEcccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHccccc

***********TSLLLLFSFIIVFLSIPSFSSSSSSTDSFVFGGCAQQKYTPSSAYESNLNSLLTSLVNSATYSSYNNFTIMGSSPQDVVYGLYQCRGDLSMPDCATCVARAVTQVGGLCYQDCGGALQLQGCYVKYDNATFLGVEDKTVVFKKCGPSVGYEPDAMGRRDAVLQGLMTASGPYRVGGARDVQGLAQCVGDLSAGECQDCLVQAIGRLKSDCGTADYGDMFLGKCYVRYSTGK******************TFAIIVGLLAGVALIIIFLTFIRKVFGE***

xxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cysteine-rich repeat secretory protein 60		probable	Q0WPN8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A2E, chain A
Confidence level:very confident
Coverage over the Query: 37-142
View the alignment between query and template
View the model in PyMOL

Template: 3A2E, chain A
Confidence level:confident
Coverage over the Query: 148-243
View the alignment between query and template
View the model in PyMOL

Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 261-291
View the alignment between query and template
View the model in PyMOL