Citrus Sinensis ID: 022867

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-

MYHLRRSAISSVRSGLSCALKSEKRLLFPVSSSASAVENSAKSFSTALRSDFARPASADSKQISNGVSAHFRGQCNRGYIVNLRLPFQQMDSRVANSKTYCSARSFASKTSKQGTETSSEPKKDISTVEDPFDAPTYNIPEKPVTFTEGASYSLIILAGLGVAGAAAYAVFKELIFEPKEYKIFNKALKRIQDDGQVRVRIGSPITGYGQESRNRAARQRIPNRVYTDEFGIEHVEVNFYIRGPHGAGKVFTEMFKDKEDKQWKFTYLIVEITSPYKAQLMLESYMPAAPA

cccHHHHHHHHHHcccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccCEEEEccccccccccccccccccccccEEECccccccccccccccccccccccccccccccccccEEEEcccEEHHHHHHHHHHHHHHHHEEEEEEEcccccHHHHHHHHHHHHccHHHHHHHcccCEEECccccccHcccccccEEEEcccccEEEEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEcccccccc

*******************************************************************SAHFRGQCNRGYIVNLRLPFQQM********TYC***********************************YNIPEKPVTFTEGASYSLIILAGLGVAGAAAYAVFKELIFEPKEYKIFNKALKRIQDDGQVRVRIGSPITGYG**********RIPNRVYTDEFGIEHVEVNFYIRGPHGAGKVFTEMFKDKEDKQWKFTYLIVEITSPYKAQLMLESYM*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable mitochondrial import inner membrane translocase subunit TIM21	May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	probable	Q1G3L1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CIU, chain A
Confidence level:very confident
Coverage over the Query: 178-285
View the alignment between query and template
View the model in PyMOL