Citrus Sinensis ID: 022907


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MSNDKSVMAVIRAARPTFRNDFDKLAFAVHATFLASGHVLTATGPSADTDFTSPSTDEVGIDHWNELDDNYAFVYVKPEKGSKKVLVKCLVMNNKLLVDALADGASEPVHLEINVADFVAKNGSNYSDQFQNLEKLVTDVDKEIILQLYGSSKPASSERGEGSRLNNPDFGYFVHQGPQPLPTGTPVPPINPDLGGDVYPGPGAGMYPRRGRFGGDGGMLIGPNHPGFFGGEPDLPRGNPWPIPPGARFDPYGPPDVPGLEPNGFIRNSSRRPDGTHPDLPLRPDGSDFI
cccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccEEEEEEcccccccEEEEEEEEEccEEEEEEECcccccEEEEEEEcccccccccccHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***DKSVMAVIRAARPTFRNDFDKLAFAVHATFLASGHVLTATG*************EVGIDHWNELDDNYAFVYVKPEKGSKKVLVKCLVMNNKLLVDALADGASEPVHLEINVADFVAKNGSNYSDQFQNLEKLVTDVDKEIIL****************************************************YPG***********F***GGMLIG*****F*****************GARFDPYGPPDV*********************************
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNDKSVMAVIRAARPTFRNDFDKLAFAVHATFLASGHVLTATGPSADTDFTSPSTDEVGIDHWNELDDNYAFVYVKPEKGSKKVLVKCLVMNNKLLVDALADGASEPVHLEINVADFVAKNGSNYSDQFQNLEKLVTDVDKEIILQLYGSSKPASSERGEGSRLNNPDFGYFVHQGPQPLPTGTPVPPINPDLGGDVYPGPGAGMYPRRGRFGGDGGMLIGPNHPGFFGGEPDLPRGNPWPIPPGARFDPYGPPDVPGLEPNGFIRNSSRRPDGTHPDLPLRPDGSDFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable proteasome inhibitor Could play an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome.probableQ9M330

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VT8, chain A
Confidence level:very confident
Coverage over the Query: 3-148
View the alignment between query and template
View the model in PyMOL