Citrus Sinensis ID: 022935

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290

MPLTTANFSICPSIFLRRIRVRSPSPKFPPRFSQFSISRPNLTSPSAAMLLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFADVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVVSLASALVESLPISTKLDDNLTLTITSIAVGSLVF

cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHc

*****ANFSICPSIFLRRIRV***************************MLLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFSSGPRGAILASLTPGVNIIRMLLVGSGMWKDEATVKSMSRYGDRRELLTGPLYYAITITLACVIYWRNSPNGIAAICNLCAGDGFADVVGRRFGKRKLPYNQNKSIAGSCAMASAGFLSSIGFMYYFFSFGYMQCSWELVFGFLVVSLASALVESLPISTKLDDNLTLTITSIAVGSLVF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable phytol kinase 2, chloroplastic	Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytolmonophosphate (PMP).	probable	Q67ZM7
Probable phytol kinase 2, chloroplastic	Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytolmonophosphate (PMP).	probable	Q5N9J9
Probable phytol kinase 3, chloroplastic	Involved in the activation and reutilization of phytol from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. Catalyzes the conversion of phytol to phytolmonophosphate (PMP).	probable	Q2N2K0

Prediction of Enzyme Commission Number

No confident prediction of EC number!