Citrus Sinensis ID: 022970

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29

MAGHFPSFYKGLQVSRCKVWNIIDRTTVVKLERYHLKHHIRGAKDRSIYHQKIKIKHLANAASGHPLQSNQPDDYKPKSPLNSVINALDAFYRFSRPHTVIGTALSIVSVALLAVEKVSDISPLFFTGVLEAIAAALMMNIYIVGLNQLSDIEIDKLPLLRWKRFAVAAAMCILAVRAVVVQLAFYLHMQTHVYRRPAVFSKPLIFATAFMSFFSVVIALFKDVPDLEGDKTFGIRTFTVRLGQKRVFWTCISLLEVAYTVAILVGATSPFAWSKLITDLGRSILALIL

cccccccccccccEEECccccccccHHHHHHccccccccccccccccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccCEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc

****FPSFYKGLQVSRCKVWNIIDRTTVVKLERYHLKHHIRGAKDRSIYHQKIKIKHLA***********************SVINALDAFYRFSRPHTVIGTALSIVSVALLAVEKVSDISPLFFTGVLEAIAAALMMNIYIVGLNQLSDIEIDKLPLLRWKRFAVAAAMCILAVRAVVVQLAFYLHMQTHVYRRPAVFSKPLIFATAFMSFFSVVIALFKDVPDLEGDKTFGIRTFTVRLGQKRVFWTCISLLEVAYTVAILVGATSPFAWSKLITDLGRSILALIL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homogentisate phytyltransferase 1, chloroplastic	Involved in the synthesis of tocopherol (vitamin E). Catalyzes the condensation of homogentisate and phytyl diphosphate to form dimethylphytylhydrquinone. Tocopherol functions to limit lipid oxidation during seed desiccation, quiescence and germination and early seedling development. Protects thylakoid membrane lipids from photooxidation and is required for low-temperature adaptation.	probable	Q8VWJ1

Prediction of Enzyme Commission Number

No confident prediction of EC number!