Citrus Sinensis ID: 023017


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVAPSYAY
ccccccccHHHHHHHHHHHHcccccccccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEcccccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHccccccccc
cHHHHHHHHHHHccccccccccEEEEEEEccccEEEEEEEcccEEEEEEccHHHcccEcHHHHHHHHHHHHHHHHcccccEEEEEccccEEEccEcHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcEEcccHHHHHHHccEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MQRLKISNISRYFNDLRALSqhrtsssvtddlCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAwendpnigfvsmkgsgrafcaggdiVSLYHFMNQGKLEECKDFFRTLYSFIYLLGthlkphvailngvtmgggagvsipgtfrvacgktvfatpetligfhpdagasfylshlpghLGEFLALTGAKLNGAEMMACGLAThysvseklPLIEEELgklvtddpsVIEACLEKYsdlvypdknsvihridivdkcfglDTVEEIIDSLddvapsyay
mqrlkisnISRYFNDLRALSQhrtsssvtddlCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIdslddvapsyay
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVAPSYAY
**********RYFNDL************TDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLD********
*************************************VEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKY***********IHRIDIVDKCFGLDTVEEIIDSLDD*******
MQRLKISNISRYFNDLRALS*********DDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVAPSYAY
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVA*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVAPSYAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
Q5XF59 401 3-hydroxyisobutyryl-CoA h no no 0.878 0.630 0.711 5e-99
Q8RXN4 409 3-hydroxyisobutyryl-CoA h no no 0.982 0.691 0.582 4e-97
Q6NMB0 378 Probable 3-hydroxyisobuty no no 0.857 0.653 0.502 6e-70
Q9LKJ1 378 3-hydroxyisobutyryl-CoA h no no 0.881 0.671 0.468 9e-66
Q1PEY5 378 Probable 3-hydroxyisobuty no no 0.857 0.653 0.481 1e-64
Q9SHJ8 387 3-hydroxyisobutyryl-CoA h no no 0.843 0.627 0.412 1e-52
Q6NVY1386 3-hydroxyisobutyryl-CoA h no no 0.920 0.686 0.407 5e-49
Q8QZS1385 3-hydroxyisobutyryl-CoA h yes no 0.944 0.706 0.383 4e-47
Q5XIE6385 3-hydroxyisobutyryl-CoA h yes no 0.968 0.724 0.377 8e-47
A2VDC2385 3-hydroxyisobutyryl-CoA h N/A no 0.940 0.703 0.396 2e-46
>sp|Q5XF59|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 Back     alignment and function desciption
 Score =  360 bits (925), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 214/253 (84%)

Query: 28  VTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGS 87
            ++DL  QVLVEG   SR AILNRP ALNAL T+MG +L KL+K WE DPNIGFV MKGS
Sbjct: 31  TSEDLDYQVLVEGSGCSRTAILNRPPALNALTTHMGYRLQKLYKNWEEDPNIGFVMMKGS 90

Query: 88  GRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAG 147
           GRAFCAGGDIVSLYH   +G  +  ++FF +LYSFIYLLGT+LKPHVAILNGVTMGGG G
Sbjct: 91  GRAFCAGGDIVSLYHLRTRGSPDAIREFFSSLYSFIYLLGTYLKPHVAILNGVTMGGGTG 150

Query: 148 VSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMA 207
           VSIPGTFRVA  +T+FATPET+IGFHPDAGASF LSHLPG LGE+L LTG KL+GAEM+A
Sbjct: 151 VSIPGTFRVATDRTIFATPETIIGFHPDAGASFNLSHLPGRLGEYLGLTGLKLSGAEMLA 210

Query: 208 CGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCF 267
           CGLATHY  SE++P++EE+L KL+TDDPSV+E+CLEK +++ +P+K  VI RID+++KCF
Sbjct: 211 CGLATHYIRSEEVPVMEEQLKKLLTDDPSVVESCLEKCAEVAHPEKTGVIRRIDLLEKCF 270

Query: 268 GLDTVEEIIDSLD 280
             DTVEEIIDSL+
Sbjct: 271 SHDTVEEIIDSLE 283





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 Back     alignment and function description
>sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 Back     alignment and function description
>sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 Back     alignment and function description
>sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHJ8|HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana GN=At1g06550 PE=2 SV=2 Back     alignment and function description
>sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 Back     alignment and function description
>sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 Back     alignment and function description
>sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 Back     alignment and function description
>sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
255541138 415 catalytic, putative [Ricinus communis] g 0.902 0.626 0.753 1e-116
356504605 407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.868 0.614 0.74 1e-110
357512815 401 3-hydroxyisobutyryl-CoA hydrolase-like p 0.927 0.665 0.681 1e-109
224136292 415 predicted protein [Populus trichocarpa] 0.916 0.636 0.756 1e-109
225430480 407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.927 0.656 0.661 1e-105
225453474 405 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.965 0.686 0.652 1e-103
449442604 406 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.972 0.689 0.664 1e-103
223973415 406 unknown [Zea mays] gi|414867666|tpg|DAA4 0.937 0.665 0.652 1e-101
218184987 411 hypothetical protein OsI_34593 [Oryza sa 0.857 0.600 0.688 1e-100
242035143 406 hypothetical protein SORBIDRAFT_01g02960 0.875 0.620 0.686 1e-100
>gi|255541138|ref|XP_002511633.1| catalytic, putative [Ricinus communis] gi|223548813|gb|EEF50302.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/260 (75%), Positives = 232/260 (89%)

Query: 24  TSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVS 83
           ++S+  DDL  QVLVE KA SR AILNRPSALNALNTNMGA+L KL+K+WE +P++GFV 
Sbjct: 37  SNSTDDDDLDKQVLVESKAYSRTAILNRPSALNALNTNMGARLLKLYKSWEENPDVGFVM 96

Query: 84  MKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMG 143
           MKGSGRAFCAGGDIV+LY+ + +GKLE+CK+FFRTLY+FIY+LGT+LKPHVAIL+G+TMG
Sbjct: 97  MKGSGRAFCAGGDIVTLYNLVKKGKLEDCKEFFRTLYTFIYILGTYLKPHVAILDGITMG 156

Query: 144 GGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGA 203
           GGAGVSIPGTFR+A  KTVFATPETLIGFHPDAGASF+LSHLPGHLGE+LALTG  LNG 
Sbjct: 157 GGAGVSIPGTFRIATDKTVFATPETLIGFHPDAGASFHLSHLPGHLGEYLALTGETLNGV 216

Query: 204 EMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIV 263
           EM+ACGLATHYS SE+L LI+++LG+LVTDDPSVIEA LEKY DLV+PDK S +HRI+ V
Sbjct: 217 EMIACGLATHYSYSERLQLIDQQLGQLVTDDPSVIEATLEKYGDLVHPDKMSALHRIETV 276

Query: 264 DKCFGLDTVEEIIDSLDDVA 283
           D+CFG DTVEEI ++L+  A
Sbjct: 277 DRCFGYDTVEEIFEALESEA 296




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356504605|ref|XP_003521086.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357512815|ref|XP_003626696.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] gi|355520718|gb|AET01172.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224136292|ref|XP_002326825.1| predicted protein [Populus trichocarpa] gi|222835140|gb|EEE73575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225430480|ref|XP_002283319.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial [Vitis vinifera] gi|296082135|emb|CBI21140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225453474|ref|XP_002274299.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial [Vitis vinifera] gi|297734569|emb|CBI16620.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449442604|ref|XP_004139071.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|223973415|gb|ACN30895.1| unknown [Zea mays] gi|414867666|tpg|DAA46223.1| TPA: hypothetical protein ZEAMMB73_952637 [Zea mays] Back     alignment and taxonomy information
>gi|218184987|gb|EEC67414.1| hypothetical protein OsI_34593 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242035143|ref|XP_002464966.1| hypothetical protein SORBIDRAFT_01g029600 [Sorghum bicolor] gi|241918820|gb|EER91964.1| hypothetical protein SORBIDRAFT_01g029600 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
TAIR|locus:2116797 409 AT4G31810 [Arabidopsis thalian 0.982 0.691 0.589 1.6e-88
TAIR|locus:2054437 378 AT2G30660 [Arabidopsis thalian 0.857 0.653 0.502 3.3e-63
TAIR|locus:2152069 378 CHY1 "beta-hydroxyisobutyryl-C 0.881 0.671 0.468 1e-59
TAIR|locus:2054517 378 AT2G30650 [Arabidopsis thalian 0.857 0.653 0.481 2.2e-59
TAIR|locus:2009180 387 AT1G06550 [Arabidopsis thalian 0.843 0.627 0.412 7.4e-50
UNIPROTKB|Q6NVY1386 HIBCH "3-hydroxyisobutyryl-CoA 0.961 0.717 0.4 1.2e-47
RGD|1308392385 Hibch "3-hydroxyisobutyryl-CoA 0.944 0.706 0.393 1.3e-45
MGI|MGI:1923792385 Hibch "3-hydroxyisobutyryl-Coe 0.954 0.714 0.390 2.1e-45
UNIPROTKB|Q5ZJ60385 HIBCH "3-hydroxyisobutyryl-CoA 0.930 0.696 0.379 7.1e-45
UNIPROTKB|F1P188385 HIBCH "3-hydroxyisobutyryl-CoA 0.930 0.696 0.379 9.1e-45
TAIR|locus:2116797 AT4G31810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 884 (316.2 bits), Expect = 1.6e-88, P = 1.6e-88
 Identities = 171/290 (58%), Positives = 223/290 (76%)

Query:     1 MQRLK-ISNISRYFNDLRALSQHRTSS-----SVTD-DLCNQVLVEGKANSRMAILNRPS 53
             MQ +K +  +S     +R++S  R  S     S +D D  +QVLVEGKA SR AILN PS
Sbjct:     1 MQTVKALRRVSEPLQWVRSVSYGRRFSALPNYSASDADFEDQVLVEGKAKSRAAILNNPS 60

Query:    54 ALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECK 113
             +LNAL+  M  +L +L+++WE +P I FV MKGSG+ FC+G D++SLYH +N+G  EE K
Sbjct:    61 SLNALSAPMVGRLKRLYESWEENPAISFVLMKGSGKTFCSGADVLSLYHSINEGNTEESK 120

Query:   114 DFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFH 173
              FF  LY F+YL GT+LKP++AI++GVTMG G G+S+PG FRVA  KTV A PE  IGFH
Sbjct:   121 LFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMFRVATDKTVLAHPEVQIGFH 180

Query:   174 PDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTD 233
             PDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLIEE +GKL+TD
Sbjct:   181 PDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLIEERIGKLLTD 240

Query:   234 DPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVA 283
             DP+VIE  L +Y DLVYPD +SV+H+I+++DK FGLDTVEEII+++++ A
Sbjct:   241 DPAVIEDSLAQYGDLVYPDSSSVLHKIELIDKYFGLDTVEEIIEAMENEA 290




GO:0003824 "catalytic activity" evidence=IEA
GO:0003860 "3-hydroxyisobutyryl-CoA hydrolase activity" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2054437 AT2G30660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152069 CHY1 "beta-hydroxyisobutyryl-CoA hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054517 AT2G30650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009180 AT1G06550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NVY1 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308392 Hibch "3-hydroxyisobutyryl-CoA hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1923792 Hibch "3-hydroxyisobutyryl-Coenzyme A hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJ60 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P188 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.40.97.1
hypothetical protein (381 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_VIII0916
enoyl-CoA hydratase (EC-4.2.1.17) (265 aa)
     0.907
grail3.0006050201
enoyl-CoA hydratase (EC-4.2.1.17) (265 aa)
     0.907
estExt_fgenesh4_pg.C_LG_VI1023
SubName- Full=Putative uncharacterized protein; (380 aa)
     0.907
eugene3.00013051
hypothetical protein (348 aa)
     0.900

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
PLN02851 407 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol 1e-150
PLN02157 401 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrol 1e-136
PLN02874 379 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol 4e-92
PLN02988 381 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol 1e-80
PRK05617342 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol 2e-76
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 4e-40
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 2e-37
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 8e-23
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 1e-20
PRK06072248 PRK06072, PRK06072, enoyl-CoA hydratase; Provision 7e-18
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 7e-18
PRK08138261 PRK08138, PRK08138, enoyl-CoA hydratase; Provision 2e-17
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 2e-17
PRK05862257 PRK05862, PRK05862, enoyl-CoA hydratase; Provision 5e-16
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 2e-15
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 8e-15
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 2e-14
PRK06210272 PRK06210, PRK06210, enoyl-CoA hydratase; Provision 9e-14
PRK05870249 PRK05870, PRK05870, enoyl-CoA hydratase; Provision 1e-13
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 3e-13
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 6e-13
PLN02664275 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d 6e-13
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 7e-13
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 2e-12
PRK07659260 PRK07659, PRK07659, enoyl-CoA hydratase; Provision 3e-12
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 3e-12
PRK07511260 PRK07511, PRK07511, enoyl-CoA hydratase; Provision 4e-12
PRK09674255 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; 1e-11
PRK07509262 PRK07509, PRK07509, enoyl-CoA hydratase; Provision 1e-11
PRK08260296 PRK08260, PRK08260, enoyl-CoA hydratase; Provision 2e-11
PRK06142272 PRK06142, PRK06142, enoyl-CoA hydratase; Provision 2e-10
PRK07799263 PRK07799, PRK07799, enoyl-CoA hydratase; Provision 3e-10
PLN02888265 PLN02888, PLN02888, enoyl-CoA hydratase 3e-10
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 8e-10
PRK08140262 PRK08140, PRK08140, enoyl-CoA hydratase; Provision 8e-10
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 1e-09
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 1e-09
PRK07260255 PRK07260, PRK07260, enoyl-CoA hydratase; Provision 2e-09
PRK05674265 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr 3e-09
PRK06144262 PRK06144, PRK06144, enoyl-CoA hydratase; Provision 4e-09
PRK09120275 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata 5e-09
PRK06495257 PRK06495, PRK06495, enoyl-CoA hydratase; Provision 3e-08
PRK12478298 PRK12478, PRK12478, enoyl-CoA hydratase; Provision 7e-08
PRK09245266 PRK09245, PRK09245, enoyl-CoA hydratase; Provision 1e-07
PRK08150255 PRK08150, PRK08150, enoyl-CoA hydratase; Provision 2e-07
PRK07468262 PRK07468, PRK07468, enoyl-CoA hydratase; Provision 5e-07
PRK08252254 PRK08252, PRK08252, enoyl-CoA hydratase; Provision 9e-07
PRK08139266 PRK08139, PRK08139, enoyl-CoA hydratase; Validated 3e-06
PRK05981266 PRK05981, PRK05981, enoyl-CoA hydratase; Provision 4e-06
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 4e-06
TIGR01929259 TIGR01929, menB, naphthoate synthase (dihydroxynap 4e-06
TIGR03200360 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car 6e-06
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 9e-06
PRK07827260 PRK07827, PRK07827, enoyl-CoA hydratase; Provision 1e-05
PRK07938249 PRK07938, PRK07938, enoyl-CoA hydratase; Provision 2e-05
PRK08272302 PRK08272, PRK08272, enoyl-CoA hydratase; Provision 2e-05
PRK07327268 PRK07327, PRK07327, enoyl-CoA hydratase; Provision 3e-05
PRK08290288 PRK08290, PRK08290, enoyl-CoA hydratase; Provision 1e-04
PRK05864276 PRK05864, PRK05864, enoyl-CoA hydratase; Provision 2e-04
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 3e-04
PLN02921327 PLN02921, PLN02921, naphthoate synthase 6e-04
TIGR03210256 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd 7e-04
TIGR03189251 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecar 0.002
TIGR02440 699 TIGR02440, FadJ, fatty oxidation complex, alpha su 0.003
PRK07396273 PRK07396, PRK07396, dihydroxynaphthoic acid synthe 0.004
>gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
 Score =  425 bits (1093), Expect = e-150
 Identities = 182/293 (62%), Positives = 234/293 (79%), Gaps = 8/293 (2%)

Query: 1   MQRLK-ISNISRYFNDLR--ALSQHRTSSSV-----TDDLCNQVLVEGKANSRMAILNRP 52
           MQR+K +  ++     +R  ++S  R+ S++      DDL +QVLVEG+A SR AILNRP
Sbjct: 1   MQRVKALRRVAVPLQWVRFGSVSYGRSFSALPNYAANDDLQDQVLVEGRAKSRAAILNRP 60

Query: 53  SALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEEC 112
           S+LNAL   M A+L +L+++WE +P+IGFV MKGSGRAFC+G D+VSLYH +N+G +EEC
Sbjct: 61  SSLNALTIPMVARLKRLYESWEENPDIGFVLMKGSGRAFCSGADVVSLYHLINEGNVEEC 120

Query: 113 KDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGF 172
           K FF  LY F+YL GT+LKP+VAI++G+TMG GAG+SIPG FRV   KTVFA PE  +GF
Sbjct: 121 KLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVFAHPEVQMGF 180

Query: 173 HPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVT 232
           HPDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLIEE LGKL+T
Sbjct: 181 HPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLIEERLGKLLT 240

Query: 233 DDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLDDVAPS 285
           DDP+VIE  L +Y DLVYPDK+SV+H+I+ +DKCFG DTVEEII++L++ A S
Sbjct: 241 DDPAVIEDSLAQYGDLVYPDKSSVLHKIETIDKCFGHDTVEEIIEALENEAAS 293


Length = 407

>gnl|CDD|177817 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase Back     alignment and domain information
>gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|132233 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
PLN02888265 enoyl-CoA hydratase 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
PLN02921327 naphthoate synthase 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PRK07827260 enoyl-CoA hydratase; Provisional 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK06072248 enoyl-CoA hydratase; Provisional 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 100.0
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08321302 naphthoate synthase; Validated 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK12478298 enoyl-CoA hydratase; Provisional 100.0
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 100.0
PRK05869222 enoyl-CoA hydratase; Validated 100.0
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
PRK08788287 enoyl-CoA hydratase; Validated 100.0
PRK08272302 enoyl-CoA hydratase; Provisional 100.0
PRK08290288 enoyl-CoA hydratase; Provisional 100.0
PRK06213229 enoyl-CoA hydratase; Provisional 100.0
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 100.0
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 100.0
PLN02267239 enoyl-CoA hydratase/isomerase family protein 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 100.0
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 100.0
KOG1684 401 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 100.0
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.83
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.83
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.69
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.61
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.59
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.58
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.55
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.54
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.49
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.41
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.36
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.99
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 98.86
PRK10949618 protease 4; Provisional 98.86
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.81
KOG1683380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 98.77
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.7
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.64
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.62
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 98.57
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.55
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.53
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 98.5
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.48
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 98.48
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 98.47
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.44
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.42
PRK11778330 putative inner membrane peptidase; Provisional 98.39
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.3
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 98.27
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 98.25
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 98.25
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 98.23
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 98.21
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 98.13
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 98.1
PRK07189301 malonate decarboxylase subunit beta; Reviewed 98.07
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 98.02
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 97.92
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 97.84
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 97.82
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.66
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 97.64
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 97.63
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 97.59
PRK10949 618 protease 4; Provisional 97.58
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 97.53
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.33
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 97.17
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 97.04
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 96.94
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 96.1
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 95.58
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 95.25
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 95.15
PF13766118 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PD 94.58
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 91.92
KOG0540536 consensus 3-Methylcrotonyl-CoA carboxylase, non-bi 91.58
PLN02851407 3-hydroxyisobutyryl-CoA hydrolase-like protein 80.76
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.4e-55  Score=387.19  Aligned_cols=253  Identities=26%  Similarity=0.378  Sum_probs=222.4

Q ss_pred             CcEEEEeeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEEcCC-CcccccCChhhHHHhhccCChHHH
Q 023017           34 NQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSG-RAFCAGGDIVSLYHFMNQGKLEEC  112 (288)
Q Consensus        34 ~~v~~~~~~~v~~i~ln~p~~~N~l~~~~~~~l~~~l~~~~~d~~v~vvvl~g~g-~~F~aG~Dl~~~~~~~~~~~~~~~  112 (288)
                      +.|.++.+++|++||||||+++|++|.+|+.+|.++++.++.|+++|+|||||.| ++||+|.|++++............
T Consensus         3 ~~i~~~~~~~v~~itlnrp~~~Nal~~~~~~~l~~~l~~~~~d~~v~~vVl~g~g~~~F~aG~Dl~~~~~~~~~~~~~~~   82 (260)
T PRK05980          3 DTVLIEIRDGIALLTLNRPEKLNALNYALIDRLLARLDAIEVDESVRAVILTGAGDRAFSAGADIHEFSASVAAGADVAL   82 (260)
T ss_pred             ceEEEEEECCEEEEEECCcccccCCCHHHHHHHHHHHHHHhhCCCcEEEEEEeCCCCceEcCcCHHHHhhhccccchhhH
Confidence            4689999999999999999999999999999999999999999999999999999 799999999987542111111223


Q ss_pred             HHHHHHHHHHHHHHhcCCCcEEEEEcCcccccccccccccCeEEEeCceEEecccccccccCCCchHHHHhhcchHH-HH
Q 023017          113 KDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHL-GE  191 (288)
Q Consensus       113 ~~~~~~~~~l~~~l~~~~kp~Iaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l~~~~g~~-a~  191 (288)
                      ..+.+..++++..+.++||||||+|||+|+|||++|+++|||||++++++|++||+++|++|++|++++|++++|.. ++
T Consensus        83 ~~~~~~~~~~~~~l~~~~kPvIaav~G~a~GgG~~lal~cD~ria~~~a~f~~pe~~~Gl~p~~g~~~~l~~~vG~~~a~  162 (260)
T PRK05980         83 RDFVRRGQAMTARLEAFPKPVIAAVNGLAFGGGCEITEAVHLAIASERALFAKPEIRLGMPPTFGGTQRLPRLAGRKRAL  162 (260)
T ss_pred             HHHHHHHHHHHHHHHhCCCCEEEEEcCEEEhhhhHHhHhCCEEEecCCCEecCcccccCCCCCchHhhHHHhhcCHHHHH
Confidence            44555566788899999999999999999999999999999999999999999999999999999999999999999 99


Q ss_pred             HHHhcCCCCCHHHHHHcCccceecCCCChhHHHHHH-HHhhcCCHHHHHHHHHHhhccCCCChhhHHH-HHHHHHHHc-C
Q 023017          192 FLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEEL-GKLVTDDPSVIEACLEKYSDLVYPDKNSVIH-RIDIVDKCF-G  268 (288)
Q Consensus       192 ~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~~~~~-~~l~~~~~~~~~~~k~~l~~~~~~~~~~~~~-~~~~~~~~~-~  268 (288)
                      +++++|++++|+||+++||||+++|++++.+.+.++ ++++..+|.++..+|+.++............ +...+..++ +
T Consensus       163 ~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~a~~la~~~p~a~~~~K~~~~~~~~~~~~~~~~~e~~~~~~~~~~  242 (260)
T PRK05980        163 ELLLTGDAFSAERALEIGLVNAVVPHEELLPAARALARRIIRHSPVAVAAILTAVTRGLNLSIAEGLLIESEQFARMAGS  242 (260)
T ss_pred             HHHHcCCccCHHHHHHcCCCCcccCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999988887777 7999999999999999998765554444433 345566666 7


Q ss_pred             cCcHHHHHHhhcCCCCCC
Q 023017          269 LDTVEEIIDSLDDVAPSY  286 (288)
Q Consensus       269 ~~~~e~~~~~lekr~p~~  286 (288)
                      ++..+++.+|++||+|+|
T Consensus       243 ~~~~e~~~af~~kr~p~~  260 (260)
T PRK05980        243 ADLREGLAAWIERRRPAY  260 (260)
T ss_pred             hhHHHHHHHHhccCCCCC
Confidence            899999999999999986



>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PF13766 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PDB: 3JU1_A 3BPT_A Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>KOG0540 consensus 3-Methylcrotonyl-CoA carboxylase, non-biotin containing subunit/Acetyl-CoA carboxylase carboxyl transferase, subunit beta [Amino acid transport and metabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3bpt_A363 Crystal Structure Of Human Beta-Hydroxyisobutyryl-C 1e-46
4hdt_A353 Crystal Structure Of A Carnitinyl-Coa Dehydratase F 1e-29
4j2u_A365 Crystal Structure Of An Enoyl-coa Hydratase From Rh 1e-23
3ju1_A 407 Crystal Structure Of Enoyl-Coa HydrataseISOMERASE F 2e-23
2hw5_A286 The Crystal Structure Of Human Enoyl-Coenzyme A (Co 3e-16
1mj3_A260 Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata 2e-14
1ey3_A258 Structure Of Enoyl-Coa Hydratase Complexed With The 2e-14
1dub_A261 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 2e-14
3pzk_A257 Crystal Structure Of The Mycobacterium Tuberculosis 3e-14
3q0j_A258 Crystal Structure Of The Mycobacterium Tuberculosis 3e-14
2ej5_A257 Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydr 3e-14
3h81_A278 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 4e-14
3r0o_A273 Crystal Structure Of Carnitinyl-Coa Hydratase From 6e-14
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 8e-14
2pbp_A258 Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( 2e-13
3moy_A263 Crystal Structure Of Probable Enoyl-Coa Hydratase F 8e-13
3rrv_A276 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 7e-12
3r9t_A267 Structure Of Echa1_1 From Mycobacterium Paratubercu 7e-12
3r9s_A267 Structure Of A Carnitinyl-Coa Dehydratase From Myco 9e-12
3qmj_A256 Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr 1e-11
3p5m_A255 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 3e-11
2vsu_A276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 9e-11
2vsu_C275 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 9e-11
2j5i_A276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 9e-11
2vsu_E276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 9e-11
2vsu_F276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-10
3rsi_A265 The Structure Of A Putative Enoyl-Coa HydrataseISOM 1e-10
2vss_E276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 1e-10
2j5i_I276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2j5i_B276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vss_F276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 1e-10
4f47_A278 The Structure Of Enoyl-Coa Hydratase Echa19 From My 2e-09
4fzw_A258 Crystal Structure Of The Paaf-paag Hydratase-isomer 3e-09
3tlf_A274 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 9e-09
1uiy_A253 Crystal Structure Of Enoyl-Coa Hydratase From Therm 9e-09
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 1e-08
3p85_A270 Crystal Structure Enoyl-Coa Hydratase From Mycobact 2e-08
2f6q_A280 The Crystal Structure Of Human Peroxisomal Delta3, 2e-08
3qyr_A253 Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M 2e-08
2vre_A296 Crystal Structure Of Human Peroxisomal Delta3,5, De 6e-08
3qxz_A265 Crystal Structure Of A Probable Enoyl-Coa Hydratase 7e-08
4fzw_C274 Crystal Structure Of The Paaf-paag Hydratase-isomer 2e-07
3pea_A261 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 2e-07
3sll_A290 Crystal Structure Of A Probable Enoyl-Coa Hydratase 2e-07
3pe8_A256 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 6e-07
1dci_A275 Dienoyl-Coa Isomerase Length = 275 8e-07
3qka_A261 Crystal Structure Of Enoyl-Coa Hydratase Echa5 From 8e-07
3lke_A263 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 9e-07
3he2_A264 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 1e-06
1nzy_A269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 2e-06
2uzf_A273 Crystal Structure Of Staphylococcus Aureus 1,4-Dihy 2e-06
1nzy_B269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 2e-06
3myb_A286 Crystal Structure Of Enoyl-Coa Hydratase Mycobacter 2e-06
3oc7_A267 Crystal Structure Of An Enoyl-Coa Hydratase From My 4e-06
2iex_A272 Crystal Structure Of Dihydroxynapthoic Acid Synthet 4e-06
3fdu_A266 Crystal Structure Of A Putative Enoyl-Coa Hydratase 4e-06
1jxz_A269 Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe 4e-06
3trr_A256 Crystal Structure Of A Probable Enoyl-Coa Hydratase 1e-05
3hin_A275 Crystal Structure Of Putative Enoyl-Coa Hydratase F 3e-05
3ome_A282 Crystal Structure Of A Probable Enoyl-Coa Hydratase 4e-05
3t3w_A279 Crystal Structure Of Probable Enoyl-Coa Hydratase F 6e-05
3g64_A279 Crystal Structure Of Putative Enoyl-Coa Hydratase F 1e-04
2vx2_A287 Crystal Structure Of Human Enoyl Coenzyme A Hydrata 2e-04
3i47_A268 Crystal Structure Of Putative Enoyl Coa HydrataseIS 2e-04
3qxi_A265 Crystal Structure Of Enoyl-Coa Hydratase Echa1 From 2e-04
1wdk_A 715 Fatty Acid Beta-Oxidation Multienzyme Complex From 6e-04
>pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 Back     alignment and structure

Iteration: 1

Score = 183 bits (464), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 105/261 (40%), Positives = 149/261 (57%), Gaps = 5/261 (1%) Query: 31 DLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSG-R 89 D +VL+ K + + LNRP LNAL N ++ K WE DP + +KG+G + Sbjct: 3 DAAEEVLLGKKGCTGVITLNRPKFLNALTLNXIRQIYPQLKKWEQDPETFLIIIKGAGGK 62 Query: 90 AFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVS 149 AFCAGGDI + + K + FFR Y +G+ KP+VA+++G+T GGG G+S Sbjct: 63 AFCAGGDIRVISE-AEKAKQKIAPVFFREEYXLNNAVGSCQKPYVALIHGITXGGGVGLS 121 Query: 150 IPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACG 209 + G FRVA K +FA PET IG PD G ++L L G LG FLALTG +L G ++ G Sbjct: 122 VHGQFRVATEKCLFAXPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAG 181 Query: 210 LATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKY--SDLVYPDKNSVIHR-IDIVDKC 266 +ATH+ SEKL +EE+L L + I + LE Y + DK+ ++ D ++ C Sbjct: 182 IATHFVDSEKLAXLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHXDKINSC 241 Query: 267 FGLDTVEEIIDSLDDVAPSYA 287 F +TVEEII++L S+A Sbjct: 242 FSANTVEEIIENLQQDGSSFA 262
>pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 Back     alignment and structure
>pdb|4J2U|A Chain A, Crystal Structure Of An Enoyl-coa Hydratase From Rhodobacter Sphaeroides 2.4.1 Length = 365 Back     alignment and structure
>pdb|3JU1|A Chain A, Crystal Structure Of Enoyl-Coa HydrataseISOMERASE FAMILY PROTEIN Length = 407 Back     alignment and structure
>pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 Back     alignment and structure
>pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 Back     alignment and structure
>pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 Back     alignment and structure
>pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 Back     alignment and structure
>pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 Back     alignment and structure
>pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 Back     alignment and structure
>pdb|2EJ5|A Chain A, Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydratase Subunit Ii) From Geobacillus Kaustophilus Length = 257 Back     alignment and structure
>pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 Back     alignment and structure
>pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 Back     alignment and structure
>pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 Back     alignment and structure
>pdb|3RRV|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 276 Back     alignment and structure
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 Back     alignment and structure
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 Back     alignment and structure
>pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 Back     alignment and structure
>pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 Back     alignment and structure
>pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 Back     alignment and structure
>pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 Back     alignment and structure
>pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 Back     alignment and structure
>pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 Back     alignment and structure
>pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 Back     alignment and structure
>pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 Back     alignment and structure
>pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 Back     alignment and structure
>pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 Back     alignment and structure
>pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 Back     alignment and structure
>pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 Back     alignment and structure
>pdb|4FZW|C Chain C, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 274 Back     alignment and structure
>pdb|3PEA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis Str. 'ames Ancestor' Length = 261 Back     alignment and structure
>pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 Back     alignment and structure
>pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 Back     alignment and structure
>pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 Back     alignment and structure
>pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 Back     alignment and structure
>pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 Back     alignment and structure
>pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 Back     alignment and structure
>pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 Back     alignment and structure
>pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 Back     alignment and structure
>pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 Back     alignment and structure
>pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 Back     alignment and structure
>pdb|3FDU|A Chain A, Crystal Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Acinetobacter Baumannii Length = 266 Back     alignment and structure
>pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 Back     alignment and structure
>pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 Back     alignment and structure
>pdb|3HIN|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009 Length = 275 Back     alignment and structure
>pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 Back     alignment and structure
>pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 Back     alignment and structure
>pdb|3G64|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Streptomyces Coelicolor A3(2) Length = 279 Back     alignment and structure
>pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 Back     alignment and structure
>pdb|3I47|A Chain A, Crystal Structure Of Putative Enoyl Coa HydrataseISOMERASE (Crotonase) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 Length = 268 Back     alignment and structure
>pdb|3QXI|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa1 From Mycobacterium Marinum Length = 265 Back     alignment and structure
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 1e-109
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 1e-102
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 2e-31
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 5e-31
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 6e-31
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-30
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 2e-30
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 4e-30
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 4e-30
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 5e-30
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 3e-29
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 3e-29
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 3e-29
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 3e-29
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 5e-29
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 8e-29
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 8e-29
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 1e-27
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 2e-27
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 8e-27
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 4e-26
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 6e-26
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 8e-26
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 1e-25
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 2e-25
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 3e-25
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 4e-25
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 6e-25
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 6e-25
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 1e-24
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 2e-24
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 2e-24
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 3e-24
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 5e-24
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 6e-24
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 8e-24
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 9e-24
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 1e-23
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 1e-23
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 2e-23
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 2e-23
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 4e-23
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 6e-23
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 7e-23
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 7e-23
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 8e-23
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 2e-22
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 2e-22
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 2e-22
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 4e-22
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 1e-21
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 1e-21
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 1e-21
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 2e-21
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 3e-21
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 7e-21
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 1e-20
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 2e-20
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 4e-20
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 1e-19
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 2e-19
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 2e-19
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 5e-19
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 7e-19
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 1e-18
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 3e-18
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 4e-18
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 1e-17
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 1e-17
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 4e-15
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 1e-14
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 1e-12
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 Back     alignment and structure
 Score =  318 bits (818), Expect = e-109
 Identities = 103/255 (40%), Positives = 147/255 (57%), Gaps = 5/255 (1%)

Query: 31  DLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSG-R 89
           D   +VL+  K  + +  LNRP  LNAL  NM  ++    K WE DP    + +KG+G +
Sbjct: 3   DAAEEVLLGKKGCTGVITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGK 62

Query: 90  AFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVS 149
           AFCAGGDI  +       + +    FFR  Y     +G+  KP+VA+++G+TMGGG G+S
Sbjct: 63  AFCAGGDIRVISEAEKAKQ-KIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLS 121

Query: 150 IPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACG 209
           + G FRVA  K +FA PET IG  PD G  ++L  L G LG FLALTG +L G ++   G
Sbjct: 122 VHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAG 181

Query: 210 LATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNS---VIHRIDIVDKC 266
           +ATH+  SEKL ++EE+L  L +     I + LE Y      D++    +   +D ++ C
Sbjct: 182 IATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSC 241

Query: 267 FGLDTVEEIIDSLDD 281
           F  +TVEEII++L  
Sbjct: 242 FSANTVEEIIENLQQ 256


>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 100.0
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 100.0
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 100.0
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.86
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.84
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.82
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.65
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.65
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.61
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.59
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 99.15
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.98
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 98.86
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 98.85
2f6i_A215 ATP-dependent CLP protease, putative; structural g 98.81
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 98.72
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.72
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 98.34
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 98.25
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 98.21
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 98.13
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 98.1
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 98.03
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.9
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.89
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.84
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.71
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 97.65
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.62
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 97.28
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.26
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.0
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 96.99
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 96.96
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 96.84
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 96.61
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 96.13
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 95.97
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 95.66
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 95.2
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltrans 91.69
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 89.18
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=1.1e-60  Score=424.38  Aligned_cols=256  Identities=23%  Similarity=0.300  Sum_probs=223.8

Q ss_pred             CCCCcEEEEeeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEEcCCCcccccCChhhHHHhhccCChH
Q 023017           31 DLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLE  110 (288)
Q Consensus        31 ~~~~~v~~~~~~~v~~i~ln~p~~~N~l~~~~~~~l~~~l~~~~~d~~v~vvvl~g~g~~F~aG~Dl~~~~~~~~~~~~~  110 (288)
                      .|+++|.++.+++|++||||||+++|+||.+|+.+|.++++.++.|+++|+|||||.|+.||+|.|++++.........+
T Consensus        12 sM~e~il~~~~~gVa~itlnRP~~~NAl~~~m~~~L~~al~~~~~d~~vr~vVltg~G~~FcaG~Dl~~~~~~~~~~~~~   91 (274)
T 4fzw_C           12 SMMEFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRNVDPTGPAPD   91 (274)
T ss_dssp             ----CEEEEEETTEEEEEECCTTTTSCBCHHHHHHHHHHHHHHHHCTTCCEEEEEESSSCSBCCBCCC---------CCC
T ss_pred             cccccEEEEEECCEEEEEEcCcCccCCCCHHHHHHHHHHHHHHHhCCCceEEEEECCCCceeCCcChHhhhccccccchH
Confidence            36779999999999999999999999999999999999999999999999999999999999999999875432222333


Q ss_pred             HHHHHHHHHHHHHHHHhcCCCcEEEEEcCcccccccccccccCeEEEeCceEEecccccccccCCCchHHHHhhcchHH-
Q 023017          111 ECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHL-  189 (288)
Q Consensus       111 ~~~~~~~~~~~l~~~l~~~~kp~Iaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l~~~~g~~-  189 (288)
                      ....+.+.++.++..+.++||||||+|||+|+|||++|+++||+|||+++++|++||+++|++|++|++++|++++|.. 
T Consensus        92 ~~~~~~~~~~~l~~~l~~~~kPvIAav~G~a~GgG~~lalacD~ria~~~a~f~~pe~~~Gl~p~~g~~~~L~r~vG~~~  171 (274)
T 4fzw_C           92 LGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRAR  171 (274)
T ss_dssp             HHHHHHHTHHHHHHHHHHCSSCEEEEECSCEETHHHHHHHTSSEEEEETTCEEECCGGGTTCCCTTTHHHHHHHHTCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEECCceeecCceeeeccceEEECCCCEEECcccCcccCCCccHHHHHHHHhhHHH
Confidence            4445556677889999999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             HHHHHhcCCCCCHHHHHHcCccceecCCCChhHHHHHH-HHhhcCCHHHHHHHHHHhhccCCCChhhHHHH-HHHHHHHc
Q 023017          190 GEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEEL-GKLVTDDPSVIEACLEKYSDLVYPDKNSVIHR-IDIVDKCF  267 (288)
Q Consensus       190 a~~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~~~~~-~~l~~~~~~~~~~~k~~l~~~~~~~~~~~~~~-~~~~~~~~  267 (288)
                      |++|+++|++++|+||+++||||+|+|++++.+.+.++ ++++..+|.+++.+|+.++......++...+. ...+..++
T Consensus       172 A~~llltg~~i~A~eA~~~GLv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K~~l~~~~~~~l~~~l~~e~~~~~~~~  251 (274)
T 4fzw_C          172 AMGLALLGNQLSAEQAHEWGMIWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAG  251 (274)
T ss_dssp             HHHHHHHCCCEEHHHHHHTTSSSEEECGGGHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHTSSCHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHhCCcCCHHHHHHCCCceEEeChHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhhhCCHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999888888 89999999999999999998877666655443 56666777


Q ss_pred             -CcCcHHHHHHhhcCCCCCC
Q 023017          268 -GLDTVEEIIDSLDDVAPSY  286 (288)
Q Consensus       268 -~~~~~e~~~~~lekr~p~~  286 (288)
                       ++|..|++.+|+|||+|+|
T Consensus       252 ~s~d~~Egv~AF~eKR~P~f  271 (274)
T 4fzw_C          252 RSADYREGVSAFLAKRSPQF  271 (274)
T ss_dssp             TSHHHHHHHHHHHC-CCCCC
T ss_pred             cCHHHHHHHHHHhCCCCCCC
Confidence             6899999999999999998



>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 6e-28
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 7e-19
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 3e-15
d1hzda_266 c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T 3e-14
d2f6qa1245 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C 2e-13
d1q52a_297 c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacter 5e-12
d1pjha_266 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 6e-11
d1nzya_269 c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Ps 7e-10
d1wdka4310 c.14.1.3 (A:1-310) Fatty oxidation complex alpha s 1e-08
d2fw2a1258 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Hum 5e-07
d1sg4a1249 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-d 6e-07
d2a7ka1230 c.14.1.3 (A:1-230) Carbapenem biosynthes protein C 1e-05
d1szoa_249 c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus 2e-05
d1wz8a1263 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TT 4e-05
d1ef8a_261 c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Esc 2e-04
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  106 bits (265), Expect = 6e-28
 Identities = 48/162 (29%), Positives = 75/162 (46%), Gaps = 7/162 (4%)

Query: 49  LNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGK 108
           LNRP ALNAL   +  +LN+  + +E DP +G + + G  +AF AG DI  + +      
Sbjct: 22  LNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRT---- 77

Query: 109 LEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPET 168
                 +     S    +    KP +A +NG  +GGG  +++      A  K  F  PE 
Sbjct: 78  --FQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEI 135

Query: 169 LIGFHPDAGASFYLSHLPGH-LGEFLALTGAKLNGAEMMACG 209
           L+G  P AG +  L+   G  L   + LTG +++  +    G
Sbjct: 136 LLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAG 177


>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 297 Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Length = 269 Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Length = 263 Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 100.0
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 100.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 100.0
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 98.47
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 98.43
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 98.32
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 98.22
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 98.1
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 97.99
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.84
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.84
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 97.78
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 97.74
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.69
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 97.58
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 97.31
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 97.2
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 97.08
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.0
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 96.49
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 96.12
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 94.24
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Chromodomain protein CDY2A
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.9e-57  Score=395.96  Aligned_cols=253  Identities=19%  Similarity=0.286  Sum_probs=228.4

Q ss_pred             CCcEEEEeeCCEEEEEEc-CCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEEcCCCcccccCChhhHHHhhccCChHH
Q 023017           33 CNQVLVEGKANSRMAILN-RPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEE  111 (288)
Q Consensus        33 ~~~v~~~~~~~v~~i~ln-~p~~~N~l~~~~~~~l~~~l~~~~~d~~v~vvvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~  111 (288)
                      |++|.++++++|++|++| ||+++|++|.+|+.+|.++++.++.|+ +++|||+|.|+.||+|+|++++.....+.....
T Consensus         1 y~~i~v~~~~gi~~i~l~~rp~~~Nals~~~~~el~~al~~~~~d~-~~~vvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~   79 (258)
T d2fw2a1           1 YRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADD-SKLVLFSAAGSVFCCGLDFGYFVRHLRNDRNTA   79 (258)
T ss_dssp             CCSEEEEEETTEEEEEECCSSSSTTCBCHHHHHHHHHHHHHHHHSS-CSEEEEEECSSCSBCCBCHHHHHHHHHHCHHHH
T ss_pred             CceEEEEEECCEEEEEECCCCcccCCCCHHHHHHHHHHHHHHHcCC-CEEEEEecCccccccccccchhhhcccccccch
Confidence            578999999999999998 689999999999999999999999874 699999999999999999999876544444445


Q ss_pred             HHHHHHHHHHHHHHHhcCCCcEEEEEcCcccccccccccccCeEEEeCceEEecccccccccCCCchHHHHhhcchHH-H
Q 023017          112 CKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHL-G  190 (288)
Q Consensus       112 ~~~~~~~~~~l~~~l~~~~kp~Iaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l~~~~g~~-a  190 (288)
                      ..++.+.+++++..+.++|||+||+|||+|+|||++++++||+||++++++|++||+++|++|++|++++|++++|.. +
T Consensus        80 ~~~~~~~~~~~~~~i~~~~kP~Iaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l~r~ig~~~a  159 (258)
T d2fw2a1          80 SLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASA  159 (258)
T ss_dssp             HHHHHHHHHHHHHHHHHCCSCEEEEECSCEETHHHHTGGGSSEEEEETTCEEECCHHHHTCCCCTTHHHHHHHHHCHHHH
T ss_pred             hhHHHHHHHHHHHhhhccceeeeeecccccccccccccccccccceecccceeeccccccccccccccccchhhcCcccc
Confidence            567778889999999999999999999999999999999999999999999999999999999999999999999999 9


Q ss_pred             HHHHhcCCCCCHHHHHHcCccceecCCCChhHHHHHH-HHhhcCCHHHHHHHHHHhhccCCCChhhHHH-HHHHHHHHc-
Q 023017          191 EFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEEL-GKLVTDDPSVIEACLEKYSDLVYPDKNSVIH-RIDIVDKCF-  267 (288)
Q Consensus       191 ~~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~~~~~-~~l~~~~~~~~~~~k~~l~~~~~~~~~~~~~-~~~~~~~~~-  267 (288)
                      ++|+++|++++|+||+++||||+|+|++++.+.+..+ +++++.|+.+++.+|+.++......+++... +.+.+..++ 
T Consensus       160 ~~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~a~~i~~~~~~a~~~~K~~~~~~~~~~l~~~~~~e~~~~~~~~~  239 (258)
T d2fw2a1         160 NEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKALVRCNIKLELEQANERECEVLRKIWS  239 (258)
T ss_dssp             HHHHTTCCEEEHHHHHHTTSCSEEECSTTHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             chhhccCcccccccccccccccccccccccccccchhhhhhhhhhHHHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHhC
Confidence            9999999999999999999999999999998877777 8999999999999999998765444444433 356777777 


Q ss_pred             CcCcHHHHHHhhcCCCCCC
Q 023017          268 GLDTVEEIIDSLDDVAPSY  286 (288)
Q Consensus       268 ~~~~~e~~~~~lekr~p~~  286 (288)
                      ++|..|++.+|+|||+|+|
T Consensus       240 s~d~~Egi~af~EKR~p~f  258 (258)
T d2fw2a1         240 SAQGIESMLKYVENKIDEF  258 (258)
T ss_dssp             SHHHHHHHHHHHHSSCCCC
T ss_pred             CHHHHHHHHHHhCCCCCCC
Confidence            6899999999999999998



>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure