Citrus Sinensis ID: 023023

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWLIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTGDGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVEMRISD
cccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MQ******IKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWLIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWK*********GKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVQNPHSIKYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRNEEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWLIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTGDGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVEMRISD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial adenine nucleotide transporter ADNT1 Mitochondrial adenylate carrier that catalyzes specifically the transport of ATP, ADP and AMP by a counter-exchange mechanism across the inner mitochondrial membrane. Substrate preference in reconstituted proteoliposomes is ATP > AMP > ADP. May play a role in oxidative phosphorylation and be important for the provision of energy required to support growth in heterotrophic tissues.confidentO04619
Uncharacterized mitochondrial carrier YPR011C probableQ12251

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 1-213,230-284
View the alignment between query and template
View the model in PyMOL