Citrus Sinensis ID: 023026


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MSLISLASSQSVLFSSTNPAHNFSSLSHRSSRNGNWVSGRNRLHAKSADPDAGTSQVGDASSESKSGSASTSFLSVLCPLLKLFSGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGSDTQEISNSDSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYVNWSFLTSFRMWETGLPEQSCLSI
ccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHccccccccccccHHHHHccHHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHHcccccHHcccc
ccEEEEccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHccccEEEEHHHHHHHccccccEEccccccccccccccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccEEEEEEEccccccEEccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHccccccccccc
mslislassqsvlfsstnpahnfsslshrssrngnwvsgrnrlhaksadpdagtsqvgdassesksgsastSFLSVLCPLlklfsggdpsrerndtleVATSSLstlarlpwgsrslsegsdtqeisnsdsptrlqlfefeacpfcRRVREAITEldlsvevfpcpkgsirHREMVRRlggkeqfpflidpntgvsmyesGDIVNYLFQqygkgrspstgllestlitgwmptifragrgmtlwekarpdppsknmhelCVRHYVNWSFLTSFRmwetglpeqsclsi
MSLISLASSQSVLFSSTNPAHNfsslshrssrnGNWVSGRNRLHaksadpdagtsqVGDASSESKSGSASTSFLSVLCPLLKLFSGGDPSRERNDTLEVatsslstlarlpwgsrslsegsdtqeisnsdsptrlQLFEFEACPFCRRVREAIteldlsvevfpcpkgsirHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYVNWSFLTSFRMWEtglpeqsclsi
MSLIslassqsvlfssTNPAHNFSSLSHRSSRNGNWVSGRNRLHAKSADPDAGTSQVGDAssesksgsastsFLSVLCPLLKLFSGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGSDTQEISNSDSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYVNWSFLTSFRMWETGLPEQSCLSI
************************************************************************FLSVLCPLLKLF**************************************************LQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEK*********MHELCVRHYVNWSFLTSFRMWETGL********
*****************NPA*NFSS*************************************************SVLCPLLKLFSGGDPSRERNDTLEVATSSLSTLARLP***********************LQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTL**********KNMHELCVRHYVNWSFLTSFRMWETGLPEQSCLSI
**********SVLFSSTNPAHNFSSLSHRSSRNGNWVSGRNRLH***************************SFLSVLCPLLKLFSGGDPSRERNDTLEVATSSLSTLARLPWGS*****************PTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYVNWSFLTSFRMWETGL********
********S************NFSSLSHRSSRNGNWVSGRNRLHAKS************************SFLSVLCPLLKLFSGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEG*******NSDSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYVNWSFLTSFRMWETGLPEQSCLSI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLISLASSQSVLFSSTNPAHNFSSLSHRSSRNGNWVSGRNRLHAKSADPDAGTSQVGDASSESKSGSASTSFLSVLCPLLKLFSGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGSDTQEISNSDSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYVNWSFLTSFRMWETGLPEQSCLSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
225460191353 PREDICTED: uncharacterized protein LOC10 0.819 0.668 0.774 9e-98
224136091329 predicted protein [Populus trichocarpa] 0.840 0.735 0.712 2e-91
147846823381 hypothetical protein VITISV_035708 [Viti 0.819 0.619 0.670 5e-87
18413285333 thioredoxin family protein [Arabidopsis 0.868 0.750 0.632 1e-84
222423323333 AT4G10000 [Arabidopsis thaliana] 0.868 0.750 0.632 1e-84
21593568333 unknown [Arabidopsis thaliana] 0.868 0.750 0.632 2e-84
449441798355 PREDICTED: uncharacterized protein LOC10 0.760 0.616 0.684 4e-82
449490170355 PREDICTED: uncharacterized LOC101202752 0.739 0.6 0.689 9e-81
297813433336 hypothetical protein ARALYDRAFT_911277 [ 0.906 0.776 0.602 3e-78
388522169330 unknown [Lotus japonicus] 0.75 0.654 0.637 4e-77
>gi|225460191|ref|XP_002277099.1| PREDICTED: uncharacterized protein LOC100244724 [Vitis vinifera] gi|297741048|emb|CBI31360.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 200/239 (83%), Gaps = 3/239 (1%)

Query: 22  NFSSLSHRSSRNGNWVSGRNRLHAKSADPDA--GTSQVGDASSESKSGSA-STSFLSVLC 78
            FS  S R   NGNWVS  NR  AKSADPDA  G SQ  DA S   +G+  STSFLSVLC
Sbjct: 36  KFSPFSPRLLGNGNWVSQGNRFRAKSADPDADPGFSQEEDAVSSGGTGTTPSTSFLSVLC 95

Query: 79  PLLKLFSGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGSDTQEISNSDSPTRLQLF 138
           PLLKLFS GDPS+ERN  LEVATSSLSTL+R PWGSRSLS+ S ++E +  D PTRLQLF
Sbjct: 96  PLLKLFSAGDPSQERNYLLEVATSSLSTLSRFPWGSRSLSDSSQSEEATTVDPPTRLQLF 155

Query: 139 EFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMY 198
           EFEACPFCRRVREAITELDLSVEV+PCPKGS+RHREMVRR GGKEQFPFLIDPNTG+SMY
Sbjct: 156 EFEACPFCRRVREAITELDLSVEVYPCPKGSVRHREMVRRFGGKEQFPFLIDPNTGISMY 215

Query: 199 ESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMH 257
           ESG+IV YLFQQYGKG+SPSTGLLESTL TGWMPTI RAGRGMTLWEKAR DPP+K + 
Sbjct: 216 ESGEIVKYLFQQYGKGKSPSTGLLESTLFTGWMPTILRAGRGMTLWEKARLDPPAKKLE 274




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224136091|ref|XP_002327378.1| predicted protein [Populus trichocarpa] gi|222835748|gb|EEE74183.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147846823|emb|CAN82730.1| hypothetical protein VITISV_035708 [Vitis vinifera] Back     alignment and taxonomy information
>gi|18413285|ref|NP_567349.1| thioredoxin family protein [Arabidopsis thaliana] gi|30681283|ref|NP_849353.1| thioredoxin family protein [Arabidopsis thaliana] gi|332657427|gb|AEE82827.1| thioredoxin family protein [Arabidopsis thaliana] gi|332657428|gb|AEE82828.1| thioredoxin family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222423323|dbj|BAH19637.1| AT4G10000 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593568|gb|AAM65535.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449441798|ref|XP_004138669.1| PREDICTED: uncharacterized protein LOC101202752 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449490170|ref|XP_004158528.1| PREDICTED: uncharacterized LOC101202752 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297813433|ref|XP_002874600.1| hypothetical protein ARALYDRAFT_911277 [Arabidopsis lyrata subsp. lyrata] gi|297320437|gb|EFH50859.1| hypothetical protein ARALYDRAFT_911277 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388522169|gb|AFK49146.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
TAIR|locus:2140533333 AT4G10000 [Arabidopsis thalian 0.861 0.744 0.632 8.7e-79
TAIR|locus:2150655339 AT5G03880 [Arabidopsis thalian 0.402 0.342 0.483 7.3e-27
UNIPROTKB|Q8EDF5118 SO_2797 "Glutaredoxin" [Shewan 0.277 0.677 0.388 4.9e-10
TIGR_CMR|SO_2797118 SO_2797 "conserved hypothetica 0.277 0.677 0.388 4.9e-10
UNIPROTKB|Q47Y18124 CPS_3634 "Putative uncharacter 0.350 0.814 0.342 3.3e-07
TIGR_CMR|CPS_3634124 CPS_3634 "conserved hypothetic 0.350 0.814 0.342 3.3e-07
UNIPROTKB|Q884Q4125 PSPTO_2034 "Uncharacterized pr 0.288 0.664 0.313 2e-06
UNIPROTKB|Q4K8I5123 PFL_4356 "Glutaredoxin domain 0.263 0.617 0.354 2.6e-06
TAIR|locus:2140533 AT4G10000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 792 (283.9 bits), Expect = 8.7e-79, P = 8.7e-79
 Identities = 162/256 (63%), Positives = 187/256 (73%)

Query:    27 SHRSSRNGNWVSGRNRLHAKSADPDAGTSQVGDAXXXXXXXXXXXXFLSVLCPLLKLFSG 86
             S R S NGNWV  R RL+ KS++ +    +                FLS LCPLLK+FSG
Sbjct:    28 SKRISGNGNWVRERRRLYVKSSNSEGKKEEAAQKSSSNNTSS----FLSFLCPLLKVFSG 83

Query:    87 GDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGS-DTQEISNSDSPTRLQLFEFEACPF 145
             GDPS++RN  LEVATSSL+++ARLPWGSR +S GS D Q++S S+ P RLQLFEFEACPF
Sbjct:    84 GDPSQQRNHALEVATSSLASVARLPWGSR-VSTGSIDNQDVS-SNPPLRLQLFEFEACPF 141

Query:   146 CRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVN 205
             CRRVREA+TELDLSVEV+PCPKGSIRHRE+VRR GGKE FPFL+DPNT   MYESGDIV 
Sbjct:   142 CRRVREAMTELDLSVEVYPCPKGSIRHRELVRRSGGKEMFPFLVDPNTETLMYESGDIVK 201

Query:   206 YLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKNMHELCVRHYV 265
             YLF+QYG GR PSTGLLESTL TGWMPT+ RAGRGM+LW+KA  D P K M EL      
Sbjct:   202 YLFKQYGNGRGPSTGLLESTLFTGWMPTLLRAGRGMSLWDKASTDLPPK-MLELFSYENN 260

Query:   266 NWSFLTSFRMWETGLP 281
              +S L    + E  LP
Sbjct:   261 PYSRLVREALCELELP 276


GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
TAIR|locus:2150655 AT5G03880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EDF5 SO_2797 "Glutaredoxin" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2797 SO_2797 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q47Y18 CPS_3634 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3634 CPS_3634 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q884Q4 PSPTO_2034 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K8I5 PFL_4356 "Glutaredoxin domain protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00021860001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (353 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
cd0304177 cd03041, GST_N_2GST_N, GST_N family, 2 repeats of 4e-40
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 4e-17
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 1e-10
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 7e-09
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 7e-07
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 1e-06
cd0303771 cd03037, GST_N_GRX2, GST_N family, Glutaredoxin 2 2e-06
cd0165969 cd01659, TRX_superfamily, Thioredoxin (TRX) superf 1e-04
PRK10387210 PRK10387, PRK10387, glutaredoxin 2; Provisional 2e-04
COG2999215 COG2999, GrxB, Glutaredoxin 2 [Posttranslational m 3e-04
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 6e-04
TIGR02182209 TIGR02182, GRXB, Glutaredoxin, GrxB family 7e-04
>gnl|CDD|239339 cd03041, GST_N_2GST_N, GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
 Score =  134 bits (338), Expect = 4e-40
 Identities = 46/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)

Query: 134 RLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNT 193
            L+L+EFE  PFCR VRE +TEL+L V ++PCPKGS + R+     GGK Q P+L+DPNT
Sbjct: 1   PLELYEFEGSPFCRLVREVLTELELDVILYPCPKGSPK-RDKFLEKGGKVQVPYLVDPNT 59

Query: 194 GVSMYESGDIVNYLFQQY 211
           GV M+ES DIV YLF+ Y
Sbjct: 60  GVQMFESADIVKYLFKTY 77


GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Length = 77

>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239335 cd03037, GST_N_GRX2, GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>gnl|CDD|236679 PRK10387, PRK10387, glutaredoxin 2; Provisional Back     alignment and domain information
>gnl|CDD|225545 COG2999, GrxB, Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|233767 TIGR02182, GRXB, Glutaredoxin, GrxB family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.8
PRK11752264 putative S-transferase; Provisional 99.77
PRK09481211 sspA stringent starvation protein A; Provisional 99.75
PRK15113214 glutathione S-transferase; Provisional 99.74
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.71
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.68
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.68
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.68
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.68
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.67
PLN02473214 glutathione S-transferase 99.67
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.66
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.64
PRK10387210 glutaredoxin 2; Provisional 99.63
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.63
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.63
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.63
KOG0868217 consensus Glutathione S-transferase [Posttranslati 99.62
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.62
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.62
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.62
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.61
KOG0406231 consensus Glutathione S-transferase [Posttranslati 99.61
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.59
PRK10357202 putative glutathione S-transferase; Provisional 99.59
PLN02395215 glutathione S-transferase 99.59
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.59
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.59
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.59
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.58
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.58
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.58
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.58
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.57
PRK10542201 glutathionine S-transferase; Provisional 99.57
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.57
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.56
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.56
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.55
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.54
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.53
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.53
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.53
PLN02378213 glutathione S-transferase DHAR1 99.51
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.45
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.45
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.44
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.44
PLN02817265 glutathione dehydrogenase (ascorbate) 99.43
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.4
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.37
PTZ00057205 glutathione s-transferase; Provisional 99.36
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.27
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.22
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.22
PRK1063883 glutaredoxin 3; Provisional 99.09
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 99.04
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 99.02
KOG4420 325 consensus Uncharacterized conserved protein (Gangl 99.0
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.99
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.98
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.93
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.91
KOG3029 370 consensus Glutathione S-transferase-related protei 98.91
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.88
PRK1120085 grxA glutaredoxin 1; Provisional 98.87
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.87
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.81
PHA03050108 glutaredoxin; Provisional 98.77
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.77
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.74
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.73
PRK1032981 glutaredoxin-like protein; Provisional 98.73
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.69
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.69
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.68
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 98.64
PLN02907 722 glutamate-tRNA ligase 98.63
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 98.63
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.62
KOG1695206 consensus Glutathione S-transferase [Posttranslati 98.54
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 98.45
PRK10824115 glutaredoxin-4; Provisional 98.24
KOG4244281 consensus Failed axon connections (fax) protein/gl 98.14
PTZ00062204 glutaredoxin; Provisional 97.93
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 97.92
KOG1752104 consensus Glutaredoxin and related proteins [Postt 97.88
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 97.79
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 97.73
PRK01655131 spxA transcriptional regulator Spx; Reviewed 97.57
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.55
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 97.53
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 97.47
PRK12559131 transcriptional regulator Spx; Provisional 97.27
PRK13344132 spxA transcriptional regulator Spx; Reviewed 97.25
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 97.21
COG454585 Glutaredoxin-related protein [Posttranslational mo 96.96
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 96.91
PF1056872 Tom37: Outer mitochondrial membrane transport comp 96.9
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 96.64
COG1393117 ArsC Arsenate reductase and related proteins, glut 96.57
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 96.36
PRK10853118 putative reductase; Provisional 96.33
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 96.32
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 96.07
PRK10026141 arsenate reductase; Provisional 96.03
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 95.8
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 95.74
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 95.62
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 95.56
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 95.24
COG0278105 Glutaredoxin-related protein [Posttranslational mo 94.87
PHA0212575 thioredoxin-like protein 94.65
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 94.51
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 93.9
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 93.39
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 93.06
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 90.27
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 89.72
KOG2903319 consensus Predicted glutathione S-transferase [Pos 89.48
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 88.24
cd0294793 TRX_family TRX family; composed of two groups: Gro 88.09
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 87.45
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 87.4
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 84.53
KOG3027257 consensus Mitochondrial outer membrane protein Met 84.48
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 83.22
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 83.08
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 82.85
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 82.59
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 82.13
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 81.96
KOG3028 313 consensus Translocase of outer mitochondrial membr 81.44
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 81.21
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 81.11
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 80.54
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
Probab=99.80  E-value=1.4e-19  Score=136.90  Aligned_cols=77  Identities=58%  Similarity=1.113  Sum_probs=68.1

Q ss_pred             ceEEEEeCCChhHHHHHHHHHHcCCceEEEEcCCCCcCCHHHHHHhCCCCcccEEEeCCCCeeecChHHHHHHHHHHh
Q 023026          134 RLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQY  211 (288)
Q Consensus       134 ~LtLY~~e~SPfCrkVr~~L~ElgIpye~~~V~kg~~~~~efLk~lnP~~qVPvLvDpn~G~~L~ES~aIl~YL~e~Y  211 (288)
                      |++||+++.||+|++|+++|+++||+|+.+++..+....+++ .++||.++||+|+|.++|..|+||.+|++||+++|
T Consensus         1 ~~~Ly~~~~sp~~~kv~~~L~~~gi~y~~~~v~~~~~~~~~~-~~~~p~~~vP~l~~~~~~~~l~es~~I~~yL~~~~   77 (77)
T cd03041           1 PLELYEFEGSPFCRLVREVLTELELDVILYPCPKGSPKRDKF-LEKGGKVQVPYLVDPNTGVQMFESADIVKYLFKTY   77 (77)
T ss_pred             CceEecCCCCchHHHHHHHHHHcCCcEEEEECCCChHHHHHH-HHhCCCCcccEEEeCCCCeEEEcHHHHHHHHHHhC
Confidence            589999999999999999999999999999998664444565 47999999999998656799999999999999986



GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.

>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 2e-18
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 7e-16
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 1e-06
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 4e-06
2ahe_A267 Chloride intracellular channel protein 4; glutathi 9e-06
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 1e-05
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 1e-05
1axd_A209 Glutathione S-transferase I; transferase, herbicid 2e-05
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 3e-05
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 1e-04
3lxz_A229 Glutathione S-transferase family protein; structur 2e-04
3niv_A222 Glutathione S-transferase; structural genomics, PS 2e-04
2r4v_A247 XAP121, chloride intracellular channel protein 2; 2e-04
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 2e-04
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 2e-04
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 3e-04
3tou_A226 Glutathione S-transferase protein; GSH binding sit 4e-04
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 5e-04
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 5e-04
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 5e-04
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 5e-04
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 5e-04
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 7e-04
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
 Score = 80.4 bits (198), Expect = 2e-18
 Identities = 22/97 (22%), Positives = 39/97 (40%), Gaps = 7/97 (7%)

Query: 135 LQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTG 194
           ++L+ ++ CPFC + R      ++ VE+               R+ G++  P L   +  
Sbjct: 4   MKLYIYDHCPFCVKARMIFGLKNIPVELNVLQN---DDEATPTRMIGQKMVPILQKDD-S 59

Query: 195 VSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWM 231
             + ES DIV+Y+    GK             I  W+
Sbjct: 60  RYLPESMDIVHYVDNLDGKPLLTGKRNPA---IEEWL 93


>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.82
4glt_A225 Glutathione S-transferase-like protein; structural 99.8
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.8
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 99.8
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.78
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.77
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.76
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.76
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.76
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.76
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.75
3lyk_A216 Stringent starvation protein A homolog; structural 99.75
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.75
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.75
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.75
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.75
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.74
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.74
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.74
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.74
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.74
3lyp_A215 Stringent starvation protein A; structural genomic 99.74
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.74
3n5o_A235 Glutathione transferase; seattle structural genomi 99.74
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.74
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.74
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.74
4dej_A231 Glutathione S-transferase related protein; transfe 99.74
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.74
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.73
3lxz_A229 Glutathione S-transferase family protein; structur 99.73
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.73
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.73
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.73
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.73
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.73
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.73
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.73
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.72
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.72
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.72
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.72
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.72
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.72
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.72
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.72
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.71
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.71
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.71
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.7
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.7
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.7
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.7
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.7
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.69
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.69
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.69
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.69
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.69
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.69
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.69
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.69
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.68
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.68
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.68
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.68
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.68
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.68
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.68
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.68
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.67
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.67
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.66
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 99.66
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.66
4exj_A238 Uncharacterized protein; transferase-like protein, 99.66
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.66
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.66
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.66
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.65
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.65
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.65
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.65
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.65
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.65
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.64
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.64
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.64
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.64
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.64
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.64
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.64
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.63
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.62
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.62
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.62
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.62
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.6
1b8x_A 280 Protein (AML-1B); nuclear matrix targeting signal 99.57
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.55
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.55
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 99.54
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.53
1bg5_A 254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.53
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.47
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 99.47
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.38
3m1g_A 362 Putative glutathione S-transferase; ECM4-like subf 99.32
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.27
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.24
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.24
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.19
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.19
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.14
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.13
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 99.12
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 99.03
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.03
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.98
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 98.89
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 98.87
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.85
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.82
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 98.81
1kte_A105 Thioltransferase; redox-active center, electron tr 98.77
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.77
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.76
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 98.76
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.75
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.74
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 98.71
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.71
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.68
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 98.67
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 98.61
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 98.61
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.59
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.56
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.55
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 98.55
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 98.53
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 98.53
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 98.51
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.5
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 98.4
1z3e_A132 Regulatory protein SPX; bacterial transcription re 98.17
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 98.16
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 98.14
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 98.14
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 98.05
1ttz_A87 Conserved hypothetical protein; structural genomic 97.94
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.9
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.89
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.77
3l78_A120 Regulatory protein SPX; transcription, transcripti 97.74
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.74
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 97.7
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.68
3fz4_A120 Putative arsenate reductase; APC61768, structural 97.61
3gkx_A120 Putative ARSC family related protein; ARSC family 97.6
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 97.41
3rdw_A121 Putative arsenate reductase; structural genomics, 97.4
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 97.3
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 96.69
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 93.63
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 93.15
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 92.86
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 92.76
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 92.02
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 90.89
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 90.83
2l57_A126 Uncharacterized protein; structural genomics, unkn 90.81
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 90.59
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 90.57
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 90.53
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 89.98
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 89.96
2kuc_A130 Putative disulphide-isomerase; structural genomics 89.62
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 89.21
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 89.13
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 89.11
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 88.86
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 88.8
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 88.75
4euy_A105 Uncharacterized protein; structural genomics, PSI- 88.65
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 88.57
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 88.48
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 88.43
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 88.3
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 88.24
2yzu_A109 Thioredoxin; redox protein, electron transport, st 88.17
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 88.13
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 87.97
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 87.84
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 87.76
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 87.59
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 87.56
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 87.49
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 87.1
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 86.79
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 86.77
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 86.34
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 86.33
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 86.31
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 86.24
1zma_A118 Bacterocin transport accessory protein; alpha-beta 85.77
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 85.58
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 85.49
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 85.44
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 85.36
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 85.33
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 84.95
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 84.83
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 84.82
1mek_A120 Protein disulfide isomerase; electron transport, r 84.72
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 84.7
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 84.59
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 84.55
2l5l_A136 Thioredoxin; structural genomics, electron transpo 84.3
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 84.07
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 84.06
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 84.06
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 84.0
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 83.81
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 83.73
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 83.64
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 83.6
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 83.48
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 83.45
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 83.41
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 83.28
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 82.27
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 82.24
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 82.22
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 81.93
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 81.83
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 81.55
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 81.43
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 80.81
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 80.57
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
Probab=99.82  E-value=6.3e-20  Score=157.44  Aligned_cols=97  Identities=15%  Similarity=0.201  Sum_probs=83.5

Q ss_pred             CceEEEEeCCChhHHHHHHHHHHcCCceEEEEcCCCCcCCHHHHHHhCCCCcccEEEeCCCCeeecChHHHHHHHHHHhC
Q 023026          133 TRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYG  212 (288)
Q Consensus       133 ~~LtLY~~e~SPfCrkVr~~L~ElgIpye~~~V~kg~~~~~efLk~lnP~~qVPvLvDpn~G~~L~ES~aIl~YL~e~Y~  212 (288)
                      .||+||+++.||||+|||++|+|+||+|+.+.|+... +.++ +.++||.++||+|+|  +|.+|+||.+|++||+++|+
T Consensus         2 ~Mm~LY~~~~sP~~~rvr~~L~e~gi~~e~~~v~~~~-~~~~-~~~~nP~g~vPvL~~--~~~~l~ES~aI~~yL~~~~~   77 (210)
T 4hoj_A            2 VMMTLYSGITCPFSHRCRFVLYEKGMDFEIKDIDIYN-KPED-LAVMNPYNQVPVLVE--RDLVLHESNIINEYIDERFP   77 (210)
T ss_dssp             --CEEEECTTCHHHHHHHHHHHHHTCCCEEEECCTTS-CCHH-HHHHCTTCCSCEEEE--TTEEEESHHHHHHHHHHHSC
T ss_pred             ceEEEecCCCChHHHHHHHHHHHcCCCCEEEEeCCCC-CCHH-HHHHCCCCCCcEEEE--CCEEEeccHHHHHHHHHhcc
Confidence            4799999999999999999999999999999997643 3445 457999999999998  78999999999999999999


Q ss_pred             CCCCCCCChHHHHHHHhHhHH
Q 023026          213 KGRSPSTGLLESTLITGWMPT  233 (288)
Q Consensus       213 ~~~~p~~~~~era~v~~Wl~t  233 (288)
                      .....+.++.+++.+..|...
T Consensus        78 ~~~l~p~~~~~~~~~~~~~~~   98 (210)
T 4hoj_A           78 HPQLMPGDPVMRGRGRLVLYR   98 (210)
T ss_dssp             SSCSSCSSHHHHHHHHHHHHH
T ss_pred             CCCCCcccHHHHHHHHHHHHH
Confidence            877667788888888888754



>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 3e-11
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 6e-11
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 8e-11
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 2e-10
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 2e-10
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 8e-10
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 9e-10
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 1e-09
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 1e-09
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 1e-09
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 3e-09
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 5e-09
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 7e-09
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 2e-08
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 1e-07
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 1e-07
d2fnoa287 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 5e-04
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 6e-04
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 7e-04
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 0.001
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 0.002
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 0.002
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 0.003
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 0.003
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 0.003
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Microsomal prostaglandin E synthase-2
species: Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]
 Score = 57.2 bits (137), Expect = 3e-11
 Identities = 16/83 (19%), Positives = 32/83 (38%), Gaps = 2/83 (2%)

Query: 134 RLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNT 193
           +L L++++ CPFC +VR  +    L  +V           E+      K       +  +
Sbjct: 2   QLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPV--LRAEIKFSSYRKVPILVAQEGES 59

Query: 194 GVSMYESGDIVNYLFQQYGKGRS 216
              + +S  I++ L      G+ 
Sbjct: 60  SQQLNDSSVIISALKTYLVSGQP 82


>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.82
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.82
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.81
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.81
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.8
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.8
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.8
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.79
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.79
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.79
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.79
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.77
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.76
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.75
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.71
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.68
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.65
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.64
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.62
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.6
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.59
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.59
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.57
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.53
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.53
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.52
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.49
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.44
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.41
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.38
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.37
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.34
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 99.23
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.12
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.96
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.78
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.74
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.6
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 98.51
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 98.5
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 98.42
d1wjka_100 Thioredoxin-like structure containing protein C330 97.99
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 97.8
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.59
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 96.86
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.82
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 95.52
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 94.78
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 92.09
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 91.41
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 88.45
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 87.03
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 85.1
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 83.89
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 82.11
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 81.21
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 81.03
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 80.48
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Yeast prion protein ure2p, nitrogen regulation fragment
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.82  E-value=1.9e-20  Score=144.50  Aligned_cols=83  Identities=25%  Similarity=0.335  Sum_probs=72.5

Q ss_pred             CCCCceEEEEeCCChhHHHHHHHHHHcCCceEEEEcCCC--CcCCHHHHHHhCCCCcccEEEeC-CCCeeecChHHHHHH
Q 023026          130 DSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKG--SIRHREMVRRLGGKEQFPFLIDP-NTGVSMYESGDIVNY  206 (288)
Q Consensus       130 ~p~~~LtLY~~e~SPfCrkVr~~L~ElgIpye~~~V~kg--~~~~~efLk~lnP~~qVPvLvDp-n~G~~L~ES~aIl~Y  206 (288)
                      +|++.++||+++.||+|+|||++|+|+||+|+.+.++..  +...++|+ ++||.++||+|+|+ .+|..|+||.||++|
T Consensus         1 ~P~~~~tLY~~~~sp~~~kV~~~L~e~gi~ye~~~v~~~~~~~~~~~~~-~~np~g~vP~L~d~~~~~~~l~ES~aI~~Y   79 (92)
T d1k0da2           1 QPLEGYTLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFV-SVNPNARVPALIDHGMDNLSIWESGAILLH   79 (92)
T ss_dssp             CCSSSEEEEECTTCHHHHHHHHHHHHTTCCEEEEECCTTTTGGGSHHHH-TTCTTCCSCEEEEGGGTTEEEESHHHHHHH
T ss_pred             CCCCceEEeeCCCCccHHHHHHHHHHcCCCCEEEEeeccCCcccCHHHH-HHhhccccceeEEecccceEEcCHHHHHHH
Confidence            477889999999999999999999999999999988643  34456665 69999999999973 368999999999999


Q ss_pred             HHHHhCC
Q 023026          207 LFQQYGK  213 (288)
Q Consensus       207 L~e~Y~~  213 (288)
                      |+++|+.
T Consensus        80 L~~~y~~   86 (92)
T d1k0da2          80 LVNKYYK   86 (92)
T ss_dssp             HHHHHHH
T ss_pred             HHHHhCc
Confidence            9999974



>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure