Citrus Sinensis ID: 023032

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29

MAASFSSLSFFSSTIFLTSSSNKVPKPIQLAKPNSLINLPPKPLIVSSQLASPLPILSFTGEKIGETYLDLKSAAPDTARAVVHRALITDMQNKRRGTASTLTRGEVRGGGRKPYSQKKTGRARRGSNRTPLRPGGGVVFGPKPRDWSIKINKKEKRLAISTAIASAAAAENTIVVEEFDGKFERPKTKEFIEAMRRWGLDPKQKATFLVMEVSENVEKSSRNIGTLKMLTPRTLNLFDILDAETLVLTPSTVDFLNGRYGVEFEGDGDEEEEESEAREAGEESDAAE

cccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHcccccccEEEEEEccccHHHHHHHccccccEEEccccccHHHHcccccEEEcHHHHHHHHHHHccccccccccHHHHHHHHHccccccccc

**********FSSTIFLTS*****************INL***PLIVSSQLASPLPILSFTGEKIGETYLDLKSAAPDTARAVVHRALITDMQNKRRGTASTL**************************RTPLRPGGGVVFGPKPRDWSIKINKKEKRLAISTAIASAAAAENTIVVEEFDGKFERPKTKEFIEAMRRWGLDPKQKATFLVMEVSENVEKSSRNIGTLKMLTPRTLNLFDILDAETLVLTPSTVDFLNGRYGV**************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L4, chloroplastic	This protein binds directly and specifically to 23S rRNA (By similarity). May play a role in plastid transcriptional regulation.	probable	O50061
50S ribosomal protein L4, chloroplastic	This protein binds directly and specifically to 23S rRNA (By similarity). May play a role in plastid transcriptional regulation.	probable	O80361
50S ribosomal protein L4, chloroplastic	This protein (expressed without the transit peptide) is able to provoke transcription termination from the spinach chloroplast rDNA operon and the E.coli S10 operon in vitro.	probable	O49937

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain G
Confidence level:very confident
Coverage over the Query: 49-262
View the alignment between query and template
View the model in PyMOL