Citrus Sinensis ID: 023036

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MDGEELTEQETALYDRQIRVWGADAQRRLSKSHILVCGMKGTVAEFCKNIVLAGVGSLTLMDDRVVTEEAWSANFLIPPDENVYGGKTIAEVCCDSLKDFNPMVRVSVEKGDLSSLDGEFYDKFDVVVVSCCSVTTKKLINEKCRKLSKRVAFYTVDCRDSCGEIFVDLQNHKYSKQKIEETIECQLRYPSFEEAISVPWRALPRKASKLYFALRVLEQFEEAEGRSPGEISIADLPAVLKLKKELCEANVRNFKLVFVCIIGCLVIKLQSCCTLLSLFQCRHSMHPT
cccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccEEccccccccccccHHHHHHHHHHHHccccEEEECccccccccccccccccEEEEccccHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEEEccccEEEccccccccEEECccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHcccccccccccc
*****LT**ETALYDRQIRVWGADAQRRLSKSHILVCGMKGTVAEFCKNIVLAGVGSLTLMDDRVVTEEAWSANFLIPPDENVYGGKTIAEVCCDSLKDFNPMVRVSVEKGDLSSLDGEFYDKFDVVVVSCCSVTTKKLINEKCRKLSKRVAFYTVDCRDSCGEIFVDLQNHKYSKQKIEETIECQLRYPSFEEAISVPWRALPRKASKLYFALRVLEQFEEAEG***GEISIADLPAVLKLKKELCEANVRNFKLVFVCIIGCLVIKLQSCCTLLSLFQCR******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGEELTEQETALYDRQIRVWGADAQRRLSKSHILVCGMKGTVAEFCKNIVLAGVGSLTLMDDRVVTEEAWSANFLIPPDENVYGGKTIAEVCCDSLKDFNPMVRVSVEKGDLSSLDGEFYDKFDVVVVSCCSVTTKKLINEKCRKLSKRVAFYTVDCRDSCGEIFVDLQNHKYSKQKIEETIECQLRYPSFEEAISVPWRALPRKASKLYFALRVLEQFEEAEGRSPGEISIADLPAVLKLKKELCEANVRNFKLVFVCIIGCLVIKLQSCCTLLSLFQCRHSMHPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SUMO-activating enzyme subunit 1B-1 The dimeric enzyme acts as a E1 ligase for SUMO1 and SUMO2. It mediates ATP-dependent activation of SUMO proteins and formation of a thioester with a conserved cysteine residue on SAE2. Functionally redundant with its paralog SAE1A.probableP0DI12
SUMO-activating enzyme subunit 1B-2 The dimeric enzyme acts as a E1 ligase for SUMO1 and SUMO2. It mediates ATP-dependent activation of SUMO proteins and formation of a thioester with a conserved cysteine residue on SAE2. Functionally redundant with its paralog SAE1A.probableP0DI13

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMM, chain A
Confidence level:very confident
Coverage over the Query: 9-275
View the alignment between query and template
View the model in PyMOL