Citrus Sinensis ID: 023054

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MLAGGASGIGLETARVLALRKAHVIIAARNMAAANEARQLILKEDDTARVDTLKLDLSSIASIKDFAQNFIALNLPLNILINNAGIMFCPYQISEDGIEMQFATNHIGHFLLTNLLLDTMNRTAKETGIEGRIVNLSSIAHQYTYKGGIRFQKINDRAGYSDKKAYGQSKLANILHANELSRRFQEEGVNITANSVHPGLIMTNLFKHSAVVMRFLKFFSFFLWKNVPQGAATTCYVALHPNLKGVTGKYFLDCNEMPPSALARDETLAKKLWDFSNKMINSASKTSA
cccccccccHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEECcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccc
MLAGGASGIGLETARVLALRKAHVIIAARNMAAANEARQLILKEDDTARVDTLKLDLSSIASIKDFAQNFIALNLPLNILINNAGIMFCPYQISEDGIEMQFATNHIGHFLLTNLLLDTMNRTAKETGIEGRIVNLSSIAHQYTYKGGIRFQKINDRAGYSDKKAYGQSKLANILHANELSRRFQEEGVNITANSVHPGLIMTNLFKHSAVVMRFLKFFSFFLWKNVPQGAATTCYVALHPNLKGVTGKYFLDCNEMPPSALARDETLAKKLWDFSNKM**S******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAGGASGIGLETARVLALRKAHVIIAARNMAAANEARQLILKEDDTARVDTLKLDLSSIASIKDFAQNFIALNLPLNILINNAGIMFCPYQISEDGIEMQFATNHIGHFLLTNLLLDTMNRTAKETGIEGRIVNLSSIAHQYTYKGGIRFQKINDRAGYSDKKAYGQSKLANILHANELSRRFQEEGVNITANSVHPGLIMTNLFKHSAVVMRFLKFFSFFLWKNVPQGAATTCYVALHPNLKGVTGKYFLDCNEMPPSALARDETLAKKLWDFSNKMINSASKTSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Retinol dehydrogenase 12 Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Might be the key enzyme in the formation of 11-cis-retinal from 11-cis-retinol during regeneration of the cone visual pigments.probableQ8BYK4
Short-chain dehydrogenase TIC 32, chloroplastic Involved in protein precursor import into chloroplasts. Part of the redox regulon consisting of TIC32, TIC 55 and TIC62. Has a NADPH-dependent dehydrogenase activity, but only after preincubation with lipids.probableQ6RVV4
Uncharacterized oxidoreductase C736.13 probableO74959

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 1-205,224-282
View the alignment between query and template
View the model in PyMOL
Template: 3IOY, chain A
Confidence level:very confident
Coverage over the Query: 1-144,160-202,220-242
View the alignment between query and template
View the model in PyMOL