Citrus Sinensis ID: 023059


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MNFNNVKVPKMPGGGAVSALIKVGVIGGLGLYAATHSLYNVEGGHRAIMFNRIVGVKDKVYPEGTHLMIPWFERPVIYDVRARPNLVESTTGSHDLQMVKIGLRVLTRPVADQLPTIYRTLGENYNERVLPSIIHETLKAVVAQYNASQLITQRETVSREIRKILTERAAYFNIALDDVSITSLTFGKEFTFAIEAKQVAAQEAERAKFIVEKAEQDKKGAIIRAQGEATSAQLIGQAIAKNPAFITLRKIEAAREIAQTISKSSNKVYLNADDLLLNLQEMKLDNSQ
cccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEECcccCEEEEEcccccccccccccccEEEccccccCEEEEEEEEEEECccccccccccEEEEEEEEEEECcccccccHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccCEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccc
**************GAVSALIKVGVIGGLGLYAATHSLYNVEGGHRAIMFNRIVGVKDKVYPEGTHLMIPWFERPVIYDVRARPNLVESTTGSHDLQMVKIGLRVLTRPVADQLPTIYRTLGENYNERVLPSIIHETLKAVVAQYNASQLITQRETVSREIRKILTERAAYFNIALDDVSITSLTFGKEFTFAIEAKQVAAQEAERAKFIVE*******GAIIRAQGEATSAQLIGQAIAKNPAFITLRKIEAAREIAQTISKSSNKVYLNADDLLLNL*********
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFNNVKVPKMPGGGAVSALIKVGVIGGLGLYAATHSLYNVEGGHRAIMFNRIVGVKDKVYPEGTHLMIPWFERPVIYDVRARPNLVESTTGSHDLQMVKIGLRVLTRPVADQLPTIYRTLGENYNERVLPSIIHETLKAVVAQYNASQLITQRETVSREIRKILTERAAYFNIALDDVSITSLTFGKEFTFAIEAKQVAAQEAERAKFIVEKAEQDKKGAIIRAQGEATSAQLIGQAIAKNPAFITLRKIEAAREIAQTISKSSNKVYLNADDLLLNLQEMKLDNSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Prohibitin-2, mitochondrial Prohibitin probably acts as a holdase/unfoldase for the stabilization of newly synthesized mitochondrial proteins.confidentQ9ZNT7
Prohibitin-2 Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.probableA9UMS3
Prohibitin-2 Prohibitin probably acts as a holdase/unfoldase for the stabilization of newly synthesized mitochondrial proteins.probableO94550

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 71-198,213-253
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 38-188
View the alignment between query and template
View the model in PyMOL