Citrus Sinensis ID: 023087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MLRCGFGLLMYGFGSKKALLEDFASTALTEYSVVVINGYLQSINIKQVVITLAEVLWNQCKSKRKTPSGNLPRAQQPFNSRSMDDLFAFLDGSELKENDYFVCVVIHNIDGPGLRDSETQQHLGRIAFCSHIRMIASIDHVNAPLLWDKKMVHTQFNWHWYHVPTFAPYKVEGMFFPLILAHGSSAQTAKTAAIVLQSLTPNAQSVFKILAEYQLSHPDEEGMPIDTLYATSRERFLVSSQVTLNSHLTEFKDHELVKTRRHSDGQDCFYIPLASEALEKLLSEINQ
cccccccEEEEccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccccEEEEEEEcccccccccHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccEEEEccccccccccHHHccHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHcccccEEEEEEcccccEEEEEEccHHHHHHHHHHHHc
MLRCGFGLLMYGFGSKKALLEDFASTALTEYSVVVINGYLQSINIKQVVITLAEVLWNQCK******************SRSMDDLFAFLDGSELKENDYFVCVVIHNIDGPGLRDSETQQHLGRIAFCSHIRMIASIDHVNAPLLWDKKMVHTQFNWHWYHVPTFAPYKVEGMFFPLILAHGSSAQTAKTAAIVLQSLTPNAQSVFKILAEYQLSHPDEEGMPIDTLYATSRERFLVSSQVTLNSHLTEFKDHELVKTRRHSDGQDCFYIPLASEALEKLLSEI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRCGFGLLMYGFGSKKALLEDFASTALTEYSVVVINGYLQSINIKQVVITLAEVLWNQCKSKRKTPSGNLPRAQQPFNSRSMDDLFAFLDGSELKENDYFVCVVIHNIDGPGLRDSETQQHLGRIAFCSHIRMIASIDHVNAPLLWDKKMVHTQFNWHWYHVPTFAPYKVEGMFFPLILAHGSSAQTAKTAAIVLQSLTPNAQSVFKILAEYQLSHPDEEGMPIDTLYATSRERFLVSSQVTLNSHLTEFKDHELVKTRRHSDGQDCFYIPLASEALEKLLSEINQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Origin recognition complex subunit 2 Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.probableQ38899

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QBY, chain A
Confidence level:probable
Coverage over the Query: 5-58,70-284
View the alignment between query and template
View the model in PyMOL