Citrus Sinensis ID: 023108

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MAKDIEVGREGEFHDKDYHDPPPAPLIGAEELTRWSFYRAIIAEFIATLLFLYITVLTVIGHKSQTDAKHGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRKARDPHVPVLAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIAALYHQFILRASASKALGSRRSSSNI
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHEEEEECcccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
************************PLIGAEELTRWSFYRAIIAEFIATLLFLYITVLTVIGHKSQTDAKHGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRKARDPHVPVLAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIAALYHQFILRA***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKDIEVGREGEFHDKDYHDPPPAPLIGAEELTRWSFYRAIIAEFIATLLFLYITVLTVIGHKSQTDAKHGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSATDPKRKARDPHVPVLAPLSIGFAVFMVHLATIPVTGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIAALYHQFILRASASKALGSRRSSSNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aquaporin PIP2-2 Water channel required to facilitate the transport of water across cell membrane. Plays an predominant role in root water uptake process in conditions of reduced transpiration, and in osmotic fluid transport. Its function is impaired by Hg(2+). Inhibited by cytosolic acidosis which occurs during anoxia in roots.confidentP43287
Aquaporin PIP2-3 Water channel required to facilitate the transport of water across cell membrane; mercury-insensitive.confidentP30302
Probable aquaporin PIP2-2 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.confidentQ6K215

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CN5, chain A
Confidence level:very confident
Coverage over the Query: 32-274
View the alignment between query and template
View the model in PyMOL