Citrus Sinensis ID: 023146


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MARLDSSDSEPEESENLSSEEEESEAPNINSNGEKEHEISAYEKQRLSRIAENKARMEAMGLSKLASSLMGSPQNLSKCKGKRKVLEDDEDYRPNDEDEGEDEDEDGGGDDDDAEFLGNKASRSYKMKGKNKSSIQKKKSSTRKKKATIQKQLSSSDCVAAAADDDELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
ccccccccccccHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccc
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHccccccccEEcccccccccccccccccccccccHcccccHHHHHHHHHHHccccHccccccccccccccccccccccccccHccccHHHcHHHHHHHHHHHHcccccccEcHHHHHHHHHHccccccHHHHHHHHHHHcccccccEcHHHHHHHHHHcccc
marldssdsepeesenlsseeeeseapninsngekehEISAYEKQRLSRIAENKARMEAMGLSKLASslmgspqnlskckgkrkvleddedyrpndedegedededgggddddaeflgnkasrsykmkgknkssiQKKKSSTRKKKATIQKqlsssdcvaaaaDDDELMQAIALslqpseelsaptqngkkgiacgrentgmgkrkkSFTARVKMTEDEVILHFFqfndaekgsislrdlrrvsvahdfiwtddelfdmihcfdsdgdgklnLEDFQKIVSRCNMI
marldssdsepeesenlsseeeeseapninsngekeheISAYEKQRLSRIAENKARMEAMGLSKLASslmgspqnlskckgkrkvleddedyrpndedegedededgggddddaeflgnkasrsykmkgknkssiqkkksstrkkkatiqkqlsssdcVAAAADDDELMQAIALSLqpseelsaptqngkkgiacgrentgmgkrkksFTARVKMTEDEVILHFfqfndaekgsislrdlrrVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
MARLDssdsepeesenlsseeeeseAPNINSNGEKEHEISAYEKQRLSRIAENKARMEAMGLSKLASSLMGSPQNLSKCKGKRKVLEDDEDYRPNdedegedededgggddddAEFLGNKASRSYkmkgknkssiqkkksstrkkkATIQKQLsssdcvaaaadddELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
*******************************************************************************************************************************************************************************************************************RVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIV******
*******************************************************************************************************************************************************QLSSSDCVAAAADDDELMQAIALSL****************IACGRENTGMGKRK***********DEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
***************************************SAYEKQRLSRIAENKARMEAMGLSKLASSLMGSPQNLSKCKGKRKVLEDDE*******************DDDDAEFLGNKASRS**********************************VAAAADDDELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
**************************************ISAYEKQRLSRIAENKARMEAMGLSKLASSL****************************************************************************************C*AAAADDDELMQAIALSLQ********************************TARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARLDSSDSEPEESENLSSEEEESEAPNINSNGEKEHEISAYEKQRLSRIAENKARMEAMGLSKLASSLMGSPQNLSKCKGKRKVLEDDEDYRPNDEDEGEDEDEDGGGDDDDAEFLGNKASRSYKMKGKNKSSIQKKKSSTRKKKATIQKQLSSSDCVAAAADDDELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
P41209172 Centrin-1 OS=Mus musculus yes no 0.244 0.406 0.414 1e-06
Q32LE3172 Centrin-1 OS=Bos taurus G no no 0.244 0.406 0.385 5e-06
Q12798172 Centrin-1 OS=Homo sapiens yes no 0.244 0.406 0.385 8e-06
Q9R1K9172 Centrin-2 OS=Mus musculus no no 0.244 0.406 0.371 2e-05
Q24956176 Caltractin OS=Giardia int N/A no 0.220 0.357 0.428 5e-05
Q06827168 Caltractin OS=Scherffelia N/A no 0.241 0.410 0.376 6e-05
Q2TBN3172 Centrin-2 OS=Bos taurus G no no 0.244 0.406 0.357 6e-05
O35648167 Centrin-3 OS=Mus musculus no no 0.223 0.383 0.437 8e-05
O15182167 Centrin-3 OS=Homo sapiens no no 0.223 0.383 0.437 8e-05
P41208172 Centrin-2 OS=Homo sapiens no no 0.244 0.406 0.357 9e-05
>sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 Back     alignment and function desciption
 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (65%)

Query: 216 TEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLED 275
           T++E++  F  F+D E G IS ++L+RV+       TD+EL +MI   D DGDG++N E+
Sbjct: 102 TKEEILKAFRLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEE 161

Query: 276 FQKIVSRCNM 285
           F KI+ + N+
Sbjct: 162 FLKIMKKTNL 171




Plays a fundamental role in microtubule-organizing center structure and function.
Mus musculus (taxid: 10090)
>sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 Back     alignment and function description
>sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 Back     alignment and function description
>sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 Back     alignment and function description
>sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 Back     alignment and function description
>sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 Back     alignment and function description
>sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=2 SV=1 Back     alignment and function description
>sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=2 SV=2 Back     alignment and function description
>sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
224136958270 predicted protein [Populus trichocarpa] 0.811 0.859 0.538 7e-56
225454032304 PREDICTED: uncharacterized protein LOC10 0.947 0.891 0.488 6e-54
296089207292 unnamed protein product [Vitis vinifera] 0.881 0.863 0.483 8e-53
449445469286 PREDICTED: uncharacterized protein LOC10 0.954 0.954 0.431 1e-48
449522704286 PREDICTED: uncharacterized protein LOC10 0.954 0.954 0.428 7e-48
255541188283 calmodulin, putative [Ricinus communis] 0.832 0.840 0.519 1e-45
357469827292 hypothetical protein MTR_4g026500 [Medic 0.821 0.804 0.446 1e-44
388501620292 unknown [Medicago truncatula] 0.821 0.804 0.446 1e-44
356506420292 PREDICTED: uncharacterized protein LOC10 0.958 0.938 0.454 2e-44
18410357254 calmodulin-related protein [Arabidopsis 0.762 0.858 0.437 6e-38
>gi|224136958|ref|XP_002326987.1| predicted protein [Populus trichocarpa] gi|222835302|gb|EEE73737.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  223 bits (568), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 134/249 (53%), Positives = 179/249 (71%), Gaps = 17/249 (6%)

Query: 39  ISAYEKQRLSRIAENKARMEAMGLSKLASSLMGSPQNLSKCKGKRKVLEDDEDYRPNDED 98
           I+ YEKQRLSRIAENKARMEA+GL+K+A+SLMGS Q   + KGK+K + DDE+YRP DE 
Sbjct: 32  ITEYEKQRLSRIAENKARMEALGLNKMATSLMGSVQKSRQRKGKQKFV-DDEEYRPIDET 90

Query: 99  EGEDEDEDGGGDDDDAEFLGNKASRSYKMKGKNKSSIQKKKSSTRKKKATIQKQLSSSDC 158
             +D+ +D     DD +F+G ++S   +     + S + KK+        +QK +S +D 
Sbjct: 91  ASDDDGDD----FDDEDFVGGQSSSKSRRSKDKRKSSKPKKNP-------VQKHVSGADY 139

Query: 159 VAAAADDDELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKS-FTARVKMTE 217
           +    DDDELMQAIALSL  S   + P +  +K  A  +E+ G  KRKK+ F++RV+MTE
Sbjct: 140 IYG--DDDELMQAIALSLHDSANDATPKE--RKVDAQVQEDAGRKKRKKAQFSSRVQMTE 195

Query: 218 DEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQ 277
           D++ILHFFQF++A KG+I++RDLRRV++AHDF WTD EL DMIHCFD DGDGKL+L+DF+
Sbjct: 196 DDLILHFFQFDEAGKGAITMRDLRRVAIAHDFTWTDKELADMIHCFDGDGDGKLSLDDFR 255

Query: 278 KIVSRCNMI 286
           KI  RCNMI
Sbjct: 256 KIAGRCNMI 264




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225454032|ref|XP_002274864.1| PREDICTED: uncharacterized protein LOC100262506 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089207|emb|CBI38910.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445469|ref|XP_004140495.1| PREDICTED: uncharacterized protein LOC101206207 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449522704|ref|XP_004168366.1| PREDICTED: uncharacterized protein LOC101226478 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255541188|ref|XP_002511658.1| calmodulin, putative [Ricinus communis] gi|223548838|gb|EEF50327.1| calmodulin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357469827|ref|XP_003605198.1| hypothetical protein MTR_4g026500 [Medicago truncatula] gi|355506253|gb|AES87395.1| hypothetical protein MTR_4g026500 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388501620|gb|AFK38876.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356506420|ref|XP_003521981.1| PREDICTED: uncharacterized protein LOC100806103 [Glycine max] Back     alignment and taxonomy information
>gi|18410357|ref|NP_565064.1| calmodulin-related protein [Arabidopsis thaliana] gi|11120794|gb|AAG30974.1|AC012396_10 unknown protein [Arabidopsis thaliana] gi|11762206|gb|AAG40381.1|AF325029_1 At1g73440 [Arabidopsis thaliana] gi|332197340|gb|AEE35461.1| calmodulin-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
TAIR|locus:2206870254 AT1G73440 [Arabidopsis thalian 0.398 0.448 0.410 1e-36
TAIR|locus:2126886257 EDA34 "embryo sac development 0.160 0.178 0.586 2.5e-15
UNIPROTKB|J9P1A0172 CETN1 "Uncharacterized protein 0.409 0.680 0.344 4.1e-10
UNIPROTKB|Q32LH2166 CETN4 "Centrin 4" [Bos taurus 0.395 0.680 0.357 1.8e-09
MGI|MGI:1347086172 Cetn1 "centrin 1" [Mus musculu 0.251 0.418 0.416 2.2e-09
UNIPROTKB|G3V832172 Cetn1 "Protein Cetn1" [Rattus 0.251 0.418 0.416 2.2e-09
UNIPROTKB|I3L7N8172 CETN1 "Uncharacterized protein 0.251 0.418 0.402 5.9e-09
UNIPROTKB|Q32LE3172 CETN1 "Centrin-1" [Bos taurus 0.251 0.418 0.388 1e-08
UNIPROTKB|E1C5B2167 CETN3 "Uncharacterized protein 0.227 0.389 0.430 2.4e-08
UNIPROTKB|Q12798172 CETN1 "Centrin-1" [Homo sapien 0.251 0.418 0.388 2.4e-08
TAIR|locus:2206870 AT1G73440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 257 (95.5 bits), Expect = 1.0e-36, Sum P(2) = 1.0e-36
 Identities = 48/117 (41%), Positives = 79/117 (67%)

Query:   173 ALSL-QPSEELSAPTQNGKKGIACG--RENTGMGKRKKSFTARVKMTEDEVILHFFQFND 229
             ++SL +  ++L        +G   G  +E   M K++    ++ +MT+DE++++F QF++
Sbjct:   135 SVSLGEDDDDLDKAIALSLQGSVAGSDKEAATMKKKRPELMSKTQMTQDELVMYFCQFDE 194

Query:   230 AEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRCNMI 286
               KG I+LRD+ +++  HDF WT++EL DMI CFD D DGKL+L++F+KIVSRC M+
Sbjct:   195 GGKGFITLRDVAKMATVHDFTWTEEELQDMIRCFDMDKDGKLSLDEFRKIVSRCRML 251


GO:0005509 "calcium ion binding" evidence=IEA
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2126886 EDA34 "embryo sac development arrest 34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1A0 CETN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q32LH2 CETN4 "Centrin 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1347086 Cetn1 "centrin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V832 Cetn1 "Protein Cetn1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7N8 CETN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q32LE3 CETN1 "Centrin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5B2 CETN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q12798 CETN1 "Centrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 2e-08
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 2e-05
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 6e-05
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 2e-04
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-04
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 0.002
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
 Score = 52.4 bits (126), Expect = 2e-08
 Identities = 25/72 (34%), Positives = 46/72 (63%)

Query: 214 KMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNL 273
           +   +E++  F  F+D + G ISL++L+RV+       TD+EL +MI   D +GDG+++ 
Sbjct: 86  RDPREEILKAFRLFDDDKTGKISLKNLKRVAKELGETITDEELQEMIDEADRNGDGEISE 145

Query: 274 EDFQKIVSRCNM 285
           E+F +I+ + N+
Sbjct: 146 EEFYRIMKKTNL 157


Length = 158

>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.72
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.71
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.65
PTZ00183158 centrin; Provisional 99.43
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.4
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.37
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.33
PTZ00184149 calmodulin; Provisional 99.32
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.26
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.22
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.21
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.14
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.13
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.12
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.11
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.07
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.07
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.06
cd0005267 EH Eps15 homology domain; found in proteins implic 99.02
cd0021388 S-100 S-100: S-100 domain, which represents the la 99.0
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 99.0
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.95
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.91
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.83
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.82
KOG0038189 consensus Ca2+-binding kinase interacting protein 98.77
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.71
PF1465866 EF-hand_9: EF-hand domain 98.7
PTZ00183158 centrin; Provisional 98.69
PTZ00184149 calmodulin; Provisional 98.66
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.65
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.64
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.63
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.62
PLN02964 644 phosphatidylserine decarboxylase 98.42
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 98.33
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.26
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.25
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.06
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.98
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.94
PLN02964 644 phosphatidylserine decarboxylase 97.92
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.91
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.84
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 97.8
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.77
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.65
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.65
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 97.56
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 97.55
KOG0036 463 consensus Predicted mitochondrial carrier protein 97.46
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.27
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.17
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 97.17
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.1
KOG2643 489 consensus Ca2+ binding protein, contains EF-hand m 97.08
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 97.06
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.97
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 96.95
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 96.93
KOG4666412 consensus Predicted phosphate acyltransferase, con 96.9
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.88
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 96.85
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 96.84
cd0005267 EH Eps15 homology domain; found in proteins implic 96.84
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 96.76
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 96.66
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 96.63
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.62
cd0503088 calgranulins Calgranulins: S-100 domain found in p 96.51
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 96.51
cd0021388 S-100 S-100: S-100 domain, which represents the la 96.5
KOG2643 489 consensus Ca2+ binding protein, contains EF-hand m 96.42
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.3
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 96.3
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 96.21
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 96.1
KOG4065144 consensus Uncharacterized conserved protein [Funct 96.07
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.01
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 95.92
KOG0751 694 consensus Mitochondrial aspartate/glutamate carrie 95.46
PRK12309391 transaldolase/EF-hand domain-containing protein; P 94.61
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 94.35
KOG4251 362 consensus Calcium binding protein [General functio 94.07
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 93.67
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 93.12
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 92.4
KOG0377631 consensus Protein serine/threonine phosphatase RDG 92.29
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 92.2
KOG4251362 consensus Calcium binding protein [General functio 91.97
PF1465866 EF-hand_9: EF-hand domain 91.25
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 90.83
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 90.43
KOG0035890 consensus Ca2+-binding actin-bundling protein (act 90.23
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 89.13
KOG3555 434 consensus Ca2+-binding proteoglycan Testican [Gene 89.0
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 88.92
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 88.83
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 88.67
PLN02952 599 phosphoinositide phospholipase C 87.73
KOG4578421 consensus Uncharacterized conserved protein, conta 85.87
KOG4666412 consensus Predicted phosphate acyltransferase, con 85.33
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 84.12
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 81.98
KOG3866 442 consensus DNA-binding protein of the nucleobindin 81.34
KOG2562 493 consensus Protein phosphatase 2 regulatory subunit 81.27
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.72  E-value=3.6e-17  Score=138.55  Aligned_cols=126  Identities=23%  Similarity=0.271  Sum_probs=105.5

Q ss_pred             hhhhhhcCccchhcccCCHHHHHHHHHhhcCCCccCcCCccCCCCcccchHHhHHHhhhhhhhhhcccCCHHHHHHHhhh
Q 023146          147 ATIQKQLSSSDCVAAAADDDELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQ  226 (286)
Q Consensus       147 ~~~~e~~~~~~~~~~~~dd~eL~qAialsL~~s~~~s~~~d~d~~G~Idf~EFl~~~k~k~~~~~~~~~~eeeL~~aF~~  226 (286)
                      .+..++......++..++..+|+..+...           +.+++|.|+|.+|+.++...............+++.||++
T Consensus        25 i~~~el~~~lr~lg~~~t~~el~~~~~~~-----------D~dg~g~I~~~eF~~l~~~~~~~~~~~~~~~~el~eaF~~   93 (151)
T KOG0027|consen   25 ISVEELGAVLRSLGQNPTEEELRDLIKEI-----------DLDGDGTIDFEEFLDLMEKLGEEKTDEEASSEELKEAFRV   93 (151)
T ss_pred             ccHHHHHHHHHHcCCCCCHHHHHHHHHHh-----------CCCCCCeEcHHHHHHHHHhhhcccccccccHHHHHHHHHH
Confidence            45667777777777777788888777765           5568999999999999987543211111245699999999


Q ss_pred             hcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHhcCCCCCcccHHHHHHHHHhc
Q 023146          227 FNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRC  283 (286)
Q Consensus       227 fD~dgdG~Is~~EL~~~L~~lG~~LtdeEv~~mI~~~D~D~DG~IdyeEFv~ll~~~  283 (286)
                      ||.+++|+||..+|+.+|..+|..++.+++..||+.+|.|+||.|+|.+|+.+|...
T Consensus        94 fD~d~~G~Is~~el~~~l~~lg~~~~~~e~~~mi~~~d~d~dg~i~f~ef~~~m~~~  150 (151)
T KOG0027|consen   94 FDKDGDGFISASELKKVLTSLGEKLTDEECKEMIREVDVDGDGKVNFEEFVKMMSGK  150 (151)
T ss_pred             HccCCCCcCcHHHHHHHHHHhCCcCCHHHHHHHHHhcCCCCCCeEeHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999999753



>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 3e-06
2a4j_A79 Solution Structure Of The C-Terminal Domain (T94-Y1 5e-06
1m39_A89 Solution Structure Of The C-Terminal Fragment (F86- 1e-05
2obh_A143 Centrin-Xpc Peptide Length = 143 1e-05
2ggm_A172 Human Centrin 2 Xeroderma Pigmentosum Group C Prote 2e-05
3fwb_A161 Sac3:sus1:cdc31 Complex Length = 161 3e-05
2gv5_A161 Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 1 2e-04
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 44/69 (63%) Query: 218 DEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLEDFQ 277 +E++ F F+D E G IS ++L+RV+ TD+EL +MI D DGDG++N E+F Sbjct: 81 EEIMKAFRLFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEFF 140 Query: 278 KIVSRCNMI 286 +I+ + ++ Sbjct: 141 RIMKKTSLF 149
>pdb|2A4J|A Chain A, Solution Structure Of The C-Terminal Domain (T94-Y172) Of The Human Centrin 2 In Complex With A 17 Residues Peptide (P1-Xpc) From Xeroderma Pigmentosum Group C Protein Length = 79 Back     alignment and structure
>pdb|1M39|A Chain A, Solution Structure Of The C-Terminal Fragment (F86-I165) Of The Human Centrin 2 In Calcium Saturated Form Length = 89 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 Back     alignment and structure
>pdb|3FWB|A Chain A, Sac3:sus1:cdc31 Complex Length = 161 Back     alignment and structure
>pdb|2GV5|A Chain A, Crystal Structure Of Sfi1pCDC31P COMPLEX Length = 161 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-08
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-04
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-08
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-08
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-08
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 3e-05
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 3e-08
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 4e-08
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 5e-08
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 1e-07
1exr_A148 Calmodulin; high resolution, disorder, metal trans 1e-07
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-07
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-07
3fwb_A161 Cell division control protein 31; gene gating, com 2e-07
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-07
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-07
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 5e-07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 8e-07
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 9e-07
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 1e-06
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-06
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-06
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 2e-06
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-06
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-06
1y1x_A191 Leishmania major homolog of programmed cell death 4e-06
1y1x_A191 Leishmania major homolog of programmed cell death 4e-05
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 8e-06
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 8e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 9e-06
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 1e-05
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 2e-05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-05
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 2e-05
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-05
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 3e-05
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 5e-05
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 5e-05
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 6e-05
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 6e-05
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 6e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 7e-05
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 7e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 7e-05
1avs_A90 Troponin C; muscle contraction, calcium-activated, 8e-05
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 8e-05
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 9e-05
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 9e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 9e-05
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 1e-04
3sjs_A 220 URE3-BP sequence specific DNA binding protein; EF- 1e-04
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-04
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-04
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-04
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-04
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-04
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 3e-04
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 4e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 4e-04
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 4e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 5e-04
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-04
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 5e-04
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 6e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 7e-04
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
 Score = 52.6 bits (127), Expect = 1e-08
 Identities = 20/70 (28%), Positives = 44/70 (62%)

Query: 216 TEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLED 275
           + +E++  F  F+D   G+I+++DLRRV+       T++EL +MI   D + D +++ ++
Sbjct: 99  SREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDE 158

Query: 276 FQKIVSRCNM 285
           F +I+ + ++
Sbjct: 159 FIRIMKKTSL 168


>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.75
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.73
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.72
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.72
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.7
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.68
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.65
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.65
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.64
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.64
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.63
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.63
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.63
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.63
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.62
3fwb_A161 Cell division control protein 31; gene gating, com 99.62
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.61
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.61
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.61
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.6
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.6
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.6
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.59
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.59
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.59
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.58
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.58
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.57
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.57
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.57
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.57
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.56
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.56
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.56
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.55
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.55
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.53
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.53
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.51
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.51
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.51
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.51
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.51
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.5
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.5
1y1x_A191 Leishmania major homolog of programmed cell death 99.49
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.49
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.49
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.48
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.47
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.47
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.47
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.46
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.46
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.46
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.46
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.45
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.45
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.45
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.45
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.44
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.44
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.44
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.44
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.44
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.43
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.43
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.42
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.42
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.42
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.42
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.41
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.41
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.4
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.4
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.4
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.4
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.4
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.39
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.39
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.39
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.39
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.38
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.38
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.38
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.38
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.37
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.37
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.37
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.37
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.36
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.36
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.35
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.35
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.35
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.35
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.34
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.34
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.34
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.34
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.33
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.33
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.33
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.33
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.32
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.32
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.32
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.32
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.31
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.31
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.31
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.3
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.3
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.3
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.29
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.29
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.28
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.28
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.28
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.28
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.28
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.27
3li6_A66 Calcium-binding protein; calcium signaling protein 99.27
1c07_A95 Protein (epidermal growth factor receptor pathway 99.26
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.25
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.25
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.25
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.24
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.24
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.24
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.23
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.23
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.23
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.23
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.21
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.2
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.2
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.2
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.19
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.19
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.19
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.19
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.19
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.19
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.18
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.17
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.16
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.16
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.16
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.14
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.14
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.14
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.09
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.09
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.08
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.08
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.08
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.08
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.06
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.06
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.06
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.06
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.03
3fwb_A161 Cell division control protein 31; gene gating, com 99.03
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.03
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.02
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.01
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.01
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.0
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.0
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.0
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.97
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.95
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.95
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.94
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.94
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.94
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.93
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.92
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.92
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.92
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.92
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.9
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.9
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.88
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.87
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.87
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.87
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.87
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.87
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.87
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.86
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.85
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.85
3sjs_A 220 URE3-BP sequence specific DNA binding protein; EF- 98.84
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.84
1y1x_A191 Leishmania major homolog of programmed cell death 98.84
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.84
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.84
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.83
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.83
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.83
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.82
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.82
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.81
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.8
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.8
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.78
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.77
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.76
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.75
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.75
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.75
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.74
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.74
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.73
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.73
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.73
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.72
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.69
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.68
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.67
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.67
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.64
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.62
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.62
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.61
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.56
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.55
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.54
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.53
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.52
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.48
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.47
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.45
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.33
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.29
3bow_A 714 Calpain-2 catalytic subunit; cysteine protease, in 98.26
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.24
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.21
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.19
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.12
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.1
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.09
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.08
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.08
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.03
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.01
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 97.97
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.97
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.91
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 97.87
3li6_A66 Calcium-binding protein; calcium signaling protein 97.84
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 97.81
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 97.77
2lv7_A100 Calcium-binding protein 7; metal binding protein; 97.75
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.68
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.64
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 97.64
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 97.59
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 97.55
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.52
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 97.46
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 97.46
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 97.44
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 97.43
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 97.42
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 97.38
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.38
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 97.37
1avs_A90 Troponin C; muscle contraction, calcium-activated, 97.32
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.3
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 97.23
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.22
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.19
1qjt_A99 EH1, epidermal growth factor receptor substrate su 97.18
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 97.16
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 97.14
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 97.11
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.1
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 97.09
1c07_A95 Protein (epidermal growth factor receptor pathway 97.09
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 97.08
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 97.07
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 97.06
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 97.06
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 97.06
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.04
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 96.96
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 96.96
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 96.93
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 96.92
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 96.91
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 96.9
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 96.88
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 96.86
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.85
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.82
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 96.8
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 96.79
2jq6_A139 EH domain-containing protein 1; metal binding prot 96.74
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 96.55
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 96.51
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 96.24
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 96.13
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 95.67
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 95.64
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 95.25
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 94.65
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 94.52
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 93.58
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 93.54
2jrf_A184 Tubulin polymerization-promoting protein family me 91.8
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 91.38
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 90.34
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 88.7
1nub_A229 Basement membrane protein BM-40; extracellular mod 87.82
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 87.54
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 83.93
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 83.27
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 82.48
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 81.67
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
Probab=99.75  E-value=4.2e-18  Score=142.94  Aligned_cols=98  Identities=23%  Similarity=0.190  Sum_probs=84.9

Q ss_pred             ccCCCCcccchHHhHHHhhhhhhhhhcccCCHHHHHHHhhhhcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHhcC
Q 023146          186 TQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDS  265 (286)
Q Consensus       186 ~d~d~~G~Idf~EFl~~~k~k~~~~~~~~~~eeeL~~aF~~fD~dgdG~Is~~EL~~~L~~lG~~LtdeEv~~mI~~~D~  265 (286)
                      .+.+++|.|+|.+|+.++......  ......++|+.||++||.+++|+|+..+|+.+|..+|.++|++++..||..+|.
T Consensus        55 ~d~~~~g~i~f~eFl~~~~~~~~~--~~~~~~~~l~~aF~~fD~d~~G~I~~~el~~~l~~~g~~ls~~e~~~l~~~~D~  132 (159)
T 3i5g_C           55 TKKMGEKAYKLEEILPIYEEMSSK--DTGTAADEFMEAFKTFDREGQGLISSAEIRNVLKMLGERITEDQCNDIFTFCDI  132 (159)
T ss_dssp             CSSTTSCEECHHHHHHHHHHHTTC--CTTCCHHHHHHHHHHHCTTSSSEECHHHHHHHHHHSSSCCCHHHHHHHHHHTTC
T ss_pred             ccccCCCcccHHHHHHHHHHhhcc--cccchHHHHHHHHHHHhcCCCCcCcHHHHHHHHHHhCCCCCHHHHHHHHHHhCc
Confidence            355678999999999988653221  124567889999999999999999999999999999999999999999999995


Q ss_pred             --CCCCcccHHHHHHHHHhcCC
Q 023146          266 --DGDGKLNLEDFQKIVSRCNM  285 (286)
Q Consensus       266 --D~DG~IdyeEFv~ll~~~~~  285 (286)
                        |++|+|+|++|+++|+..|+
T Consensus       133 ~~d~dG~I~~~EF~~~m~~~p~  154 (159)
T 3i5g_C          133 REDIDGNIKYEDLMKKVMAGPF  154 (159)
T ss_dssp             CCCSSCCEEHHHHHHHHHHCSC
T ss_pred             CCCCCCeEeHHHHHHHHHCCCC
Confidence              88999999999999987653



>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-07
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 1e-06
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 4e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-06
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-06
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9e-06
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 1e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 2e-05
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-05
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 2e-05
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 3e-05
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 4e-05
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 7e-05
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 8e-05
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 9e-05
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 1e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 1e-04
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-04
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-04
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-04
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 3e-04
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 3e-04
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 3e-04
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 4e-04
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 7e-04
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 9e-04
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.001
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.001
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 0.002
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.002
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 0.002
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.003
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 0.004
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.004
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Caltractin (centrin 2)
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
 Score = 46.0 bits (109), Expect = 1e-07
 Identities = 20/70 (28%), Positives = 44/70 (62%)

Query: 216 TEDEVILHFFQFNDAEKGSISLRDLRRVSVAHDFIWTDDELFDMIHCFDSDGDGKLNLED 275
           + +E++  F  F+D   G+I+++DLRRV+       T++EL +MI   D + D +++ ++
Sbjct: 7   SREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDE 66

Query: 276 FQKIVSRCNM 285
           F +I+ + ++
Sbjct: 67  FIRIMKKTSL 76


>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.76
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.72
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.68
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.67
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.67
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.66
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.64
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.63
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.62
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.62
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.61
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.61
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.6
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.59
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.56
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.56
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.56
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.53
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.52
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.51
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.51
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.51
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.5
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.49
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.49
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.49
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.46
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.46
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.44
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.43
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.43
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.42
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.42
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.42
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.38
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.38
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.37
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.37
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.36
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.34
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.34
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.33
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.3
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.29
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.26
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.25
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.24
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.22
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.21
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.19
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.18
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.13
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.08
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.05
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.03
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.01
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.01
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.0
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.99
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.98
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.97
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.96
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.87
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.87
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.86
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.84
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.83
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.81
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.8
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.78
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.76
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.73
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.72
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.71
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.71
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.69
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.67
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.67
d1s6ia_ 182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.66
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.65
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.61
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 98.61
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.56
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.54
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.54
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.52
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.52
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.51
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.5
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.46
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.41
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.39
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.27
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.23
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.17
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.17
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.1
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.1
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.02
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.0
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.0
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.97
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.97
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.95
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.94
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 97.94
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.94
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.87
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 97.86
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.84
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 97.78
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.64
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 97.63
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.61
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.6
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.6
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.59
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.59
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 97.58
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.56
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 97.5
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 97.46
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.4
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 97.39
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 97.34
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 97.31
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.29
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 97.29
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 97.23
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.2
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.08
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 96.99
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 96.99
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.85
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 96.7
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 96.44
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.24
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 96.19
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 96.19
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 96.1
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 95.86
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 95.7
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 95.21
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 94.8
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 93.96
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 93.89
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 93.77
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 92.66
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 92.44
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 91.8
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 91.43
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 88.55
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 87.09
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 86.33
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 84.86
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Parvalbumin
domain: Parvalbumin
species: Leopard shark (Triakis semifasciata) [TaxId: 30493]
Probab=99.76  E-value=1.9e-18  Score=136.96  Aligned_cols=99  Identities=23%  Similarity=0.249  Sum_probs=86.1

Q ss_pred             HHHHHHHHHhhcCCCccCcCCccCCCCcccchHHhHHHhhhhhhhhhcccCCHHHHHHHhhhhcCCCCCcccHHHHHHHH
Q 023146          165 DDELMQAIALSLQPSEELSAPTQNGKKGIACGRENTGMGKRKKSFTARVKMTEDEVILHFFQFNDAEKGSISLRDLRRVS  244 (286)
Q Consensus       165 d~eL~qAialsL~~s~~~s~~~d~d~~G~Idf~EFl~~~k~k~~~~~~~~~~eeeL~~aF~~fD~dgdG~Is~~EL~~~L  244 (286)
                      ..++.++|...             +.+|.|+|.||+.++..+       ..++++|+.+|+.||.+++|+|+..||+.+|
T Consensus         8 ~~di~~~~~~~-------------~~~G~idf~eF~~~~~~~-------~~~~~~l~~~F~~~D~d~~G~I~~~El~~~l   67 (109)
T d5pala_           8 ADDINKAISAF-------------KDPGTFDYKRFFHLVGLK-------GKTDAQVKEVFEILDKDQSGFIEEEELKGVL   67 (109)
T ss_dssp             HHHHHHHHHHT-------------CSTTCCCHHHHHHHHTCT-------TCCHHHHHHHHHHHCTTCSSEECHHHHHTHH
T ss_pred             HHHHHHHHHhc-------------CCCCcCcHHHHHHHHHhc-------CCCHHHHHHHHhhhcCCCCCeEcHHHHHHHH
Confidence            67788888764             235889999999877532       3457899999999999999999999999999


Q ss_pred             HHc---CCCCCHHHHHHHHHHhcCCCCCcccHHHHHHHHHhc
Q 023146          245 VAH---DFIWTDDELFDMIHCFDSDGDGKLNLEDFQKIVSRC  283 (286)
Q Consensus       245 ~~l---G~~LtdeEv~~mI~~~D~D~DG~IdyeEFv~ll~~~  283 (286)
                      ..+   |..+++++|..||+.+|.|+||.|+|+||+.+|.+.
T Consensus        68 ~~l~~~g~~~~~~e~~~~~~~~D~d~dG~I~~~EF~~~m~~s  109 (109)
T d5pala_          68 KGFSAHGRDLNDTETKALLAAGDSDHDGKIGADEFAKMVAQA  109 (109)
T ss_dssp             HHHCTTCCCCCHHHHHHHHHHHCTTCSSSEEHHHHHHHHHHC
T ss_pred             HHhhhccCcCCHHHHHHHHHHhCCCCCCCEeHHHHHHHHHhC
Confidence            876   788999999999999999999999999999999763



>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure