Citrus Sinensis ID: 023231


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MGSSQAAVSFLTNIARAAFGLGAAATVLNSSLYTVDGGERAVLFDRFRGVIDETIGEGTHFLIPWLQKPFIFDIRTRPHTFSSVSGTKDLQMVNLTLRVLSRPEVSRLPYIFQHLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIKRARDFNIVLDDVAITHLSYGAEFSRAVEQKQVAQQEAERSKFVVMKADQERRAAIIRAEGESEAAQLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLLALNPALTGGR
cccHHHHHHHHHHHHHHHHHHHHHHHHHHccEECcccccEEEEEEccccccccCCccccEEEcccccccEEEEEEEEEEECcccccccccEEEEEEEEEEEECcccccHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEEccccccccEECccccccccc
*******VSFLTNIARAAFGLGAAATVLNSSLYTVDGGERAVLFDRFRGVIDETIGEGTHFLIPWLQKPFIFDIRTRPHTFSSVSGTKDLQMVNLTLRVLSRPEVSRLPYIFQHLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIKRARDFNIVLDDVAITHLSYGAEFSRAVEQKQV**QEAE****VV*********************QLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLL***P******
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSQAAVSFLTNIARAAFGLGAAATVLNSSLYTVDGGERAVLFDRFRGVIDETIGEGTHFLIPWLQKPFIFDIRTRPHTFSSVSGTKDLQMVNLTLRVLSRPEVSRLPYIFQHLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIKRARDFNIVLDDVAITHLSYGAEFSRAVEQKQVAQQEAERSKFVVMKADQERRAAIIRAEGESEAAQLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLLALNPALTGGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Prohibitin-3, mitochondrial Prohibitin probably acts as a holdase/unfoldase for the stabilization of newly synthesized mitochondrial proteins (By similarity). Necessary for mitochondrial and cell metabolism and biogenesis. Required to regulate the ethylene-mediated signaling; involved in growth maintainance in the presence of ethylene. Functions in nitric oxide (NO)-mediated responses and in hydrogen peroxide-induced NO accumulation.confidentO04331
Prohibitin Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.probableQ3T165
Prohibitin Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.probableP67779

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 65-192,207-248
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 32-188
View the alignment between query and template
View the model in PyMOL