Citrus Sinensis ID: 023238
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| 255572967 | 482 | cytochrome P450, putative [Ricinus commu | 0.968 | 0.572 | 0.857 | 1e-139 | |
| 224134987 | 459 | cytochrome P450 probable 6-deoxoteastero | 0.964 | 0.599 | 0.853 | 1e-137 | |
| 224128516 | 456 | cytochrome P450 probable 6-deoxoteastero | 0.964 | 0.603 | 0.85 | 1e-135 | |
| 359482509 | 478 | PREDICTED: 3-epi-6-deoxocathasterone 23- | 0.961 | 0.573 | 0.776 | 1e-129 | |
| 297743073 | 475 | unnamed protein product [Vitis vinifera] | 0.961 | 0.576 | 0.776 | 1e-129 | |
| 356526027 | 474 | PREDICTED: 3-epi-6-deoxocathasterone 23- | 0.964 | 0.580 | 0.746 | 1e-122 | |
| 356522526 | 473 | PREDICTED: 3-epi-6-deoxocathasterone 23- | 0.964 | 0.581 | 0.742 | 1e-121 | |
| 144905184 | 476 | cytochrome P450 enzyme [Pisum sativum] | 0.968 | 0.579 | 0.725 | 1e-120 | |
| 356522528 | 450 | PREDICTED: 3-epi-6-deoxocathasterone 23- | 0.968 | 0.613 | 0.726 | 1e-118 | |
| 388827889 | 512 | cytochrome P450 CYP90D18 [Bupleurum chin | 0.961 | 0.535 | 0.720 | 1e-118 |
| >gi|255572967|ref|XP_002527414.1| cytochrome P450, putative [Ricinus communis] gi|223533224|gb|EEF34980.1| cytochrome P450, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 499 bits (1284), Expect = e-139, Method: Compositional matrix adjust.
Identities = 241/281 (85%), Positives = 264/281 (93%), Gaps = 5/281 (1%)
Query: 1 MEILKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPK 60
ME LKKQFQEFI GLMSLP+NIPG+QLYRSLQAKKKM +L+Q IIQSKRDGG+S VPK
Sbjct: 201 MESLKKQFQEFICGLMSLPVNIPGTQLYRSLQAKKKMVKLVQRIIQSKRDGGIST--VPK 258
Query: 61 DVIDVLMMNNASDQPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQLTDE 120
DV++VL+ N+A+ Q LTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSD PAALQQLTDE
Sbjct: 259 DVVEVLL-NDANAQ-LTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDCPAALQQLTDE 316
Query: 121 NIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPK 180
N+KLK LKAQLGEPL+W+DYLSLPFTQ VITETLRMGNIIIGVMRKAM+DIEIKGYLIPK
Sbjct: 317 NMKLKSLKAQLGEPLTWTDYLSLPFTQRVITETLRMGNIIIGVMRKAMKDIEIKGYLIPK 376
Query: 181 GWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDISNSSFTPFGGGQRLCPGLDLARLEA 240
GWC FAYFRSVHLDE++Y+WPYQFNPWRWQD KD+SNS+FTPFGGGQRLCPGLDLARLEA
Sbjct: 377 GWCAFAYFRSVHLDENHYDWPYQFNPWRWQD-KDMSNSNFTPFGGGQRLCPGLDLARLEA 435
Query: 241 SIFLHHLVTQFRWVAEEDTVVNFPTVRMKRRMPIWVKKRED 281
SIFLH+ VTQF WVAEEDT+VNFPTVRMKRRMPIWVK+RE+
Sbjct: 436 SIFLHNFVTQFSWVAEEDTIVNFPTVRMKRRMPIWVKRREE 476
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224134987|ref|XP_002327539.1| cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] gi|222836093|gb|EEE74514.1| cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224128516|ref|XP_002329023.1| cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] gi|222839694|gb|EEE78017.1| cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359482509|ref|XP_002275659.2| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743073|emb|CBI35940.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356526027|ref|XP_003531621.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356522526|ref|XP_003529897.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|144905184|dbj|BAF56241.1| cytochrome P450 enzyme [Pisum sativum] | Back alignment and taxonomy information |
|---|
| >gi|356522528|ref|XP_003529898.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388827889|gb|AFK79027.1| cytochrome P450 CYP90D18 [Bupleurum chinense] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| TAIR|locus:2091571 | 491 | CYP90D1 ""cytochrome P450, fam | 0.964 | 0.560 | 0.686 | 3.2e-104 | |
| TAIR|locus:2115220 | 524 | ROT3 "ROTUNDIFOLIA 3" [Arabido | 0.982 | 0.534 | 0.547 | 3.8e-85 | |
| TAIR|locus:2166439 | 472 | CPD "CONSTITUTIVE PHOTOMORPHOG | 0.964 | 0.582 | 0.446 | 4.2e-63 | |
| UNIPROTKB|Q8GSQ1 | 469 | CYP85A1 "Cytochrome P450 85A1" | 0.957 | 0.582 | 0.371 | 1.7e-52 | |
| TAIR|locus:2152292 | 465 | BR6OX1 "brassinosteroid-6-oxid | 0.905 | 0.554 | 0.414 | 1.9e-51 | |
| TAIR|locus:2101704 | 513 | DWF4 "DWARF 4" [Arabidopsis th | 0.712 | 0.395 | 0.416 | 1.6e-49 | |
| TAIR|locus:2098802 | 465 | BR6OX2 "brassinosteroid-6-oxid | 0.912 | 0.559 | 0.402 | 2e-49 | |
| UNIPROTKB|Q5CCK3 | 506 | OsDWARF4 "Cytochrome P450" [Or | 0.961 | 0.541 | 0.359 | 2e-47 | |
| UNIPROTKB|Q8H848 | 502 | OJ1626B05.9 "Putative steroid | 0.961 | 0.545 | 0.359 | 2e-47 | |
| UNIPROTKB|Q6F4F5 | 480 | CYP724B1 "Cytochrome P450 724B | 0.936 | 0.556 | 0.355 | 1.9e-44 |
| TAIR|locus:2091571 CYP90D1 ""cytochrome P450, family 90, subfamily D, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1032 (368.3 bits), Expect = 3.2e-104, P = 3.2e-104
Identities = 193/281 (68%), Positives = 236/281 (83%)
Query: 1 MEILKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSK--RDGGMSNINV 58
+E LK++F+ FISGLMSLPIN PG+QL+RSLQAKK M + ++ II+ K + +V
Sbjct: 213 LEELKREFENFISGLMSLPINFPGTQLHRSLQAKKNMVKQVERIIEGKIRKTKNKEEDDV 272
Query: 59 -PKDVIDVLMMNNASDQPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQL 117
KDV+DVL+ + S + LT +LIA+NMIDMMIPG DSVPVL+TLAVK+LSD PAAL L
Sbjct: 273 IAKDVVDVLLKD--SSEHLTHNLIANNMIDMMIPGHDSVPVLITLAVKFLSDSPAALNLL 330
Query: 118 TDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGYL 177
T+EN+KLK LK GEPL W+DYLSLPFTQ VITETLRMGN+IIGVMRKAM+D+EIKGY+
Sbjct: 331 TEENMKLKSLKELTGEPLYWNDYLSLPFTQKVITETLRMGNVIIGVMRKAMKDVEIKGYV 390
Query: 178 IPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDISNSSFTPFGGGQRLCPGLDLAR 237
IPKGWCF AY RSVHLD+ YE PY+FNPWRWQ+ +D++ SSF+PFGGGQRLCPGLDLAR
Sbjct: 391 IPKGWCFLAYLRSVHLDKLYYESPYKFNPWRWQE-RDMNTSSFSPFGGGQRLCPGLDLAR 449
Query: 238 LEASIFLHHLVTQFRWVAEEDTVVNFPTVRMKRRMPIWVKK 278
LE S+FLHHLVT+FRW+AEEDT++NFPTV MK ++PIW+K+
Sbjct: 450 LETSVFLHHLVTRFRWIAEEDTIINFPTVHMKNKLPIWIKR 490
|
|
| TAIR|locus:2115220 ROT3 "ROTUNDIFOLIA 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166439 CPD "CONSTITUTIVE PHOTOMORPHOGENIC DWARF" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8GSQ1 CYP85A1 "Cytochrome P450 85A1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152292 BR6OX1 "brassinosteroid-6-oxidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101704 DWF4 "DWARF 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098802 BR6OX2 "brassinosteroid-6-oxidase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5CCK3 OsDWARF4 "Cytochrome P450" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8H848 OJ1626B05.9 "Putative steroid 22-alpha-hydroxylase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6F4F5 CYP724B1 "Cytochrome P450 724B1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 0.0 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 2e-86 | |
| PLN02774 | 463 | PLN02774, PLN02774, brassinosteroid-6-oxidase | 4e-79 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 2e-65 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 1e-58 | |
| PLN02196 | 463 | PLN02196, PLN02196, abscisic acid 8'-hydroxylase | 6e-54 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 9e-34 | |
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 3e-32 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 1e-18 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 9e-17 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 8e-16 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 8e-15 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 2e-14 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 3e-14 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 2e-13 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 2e-12 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 2e-10 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 5e-10 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 5e-10 | |
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 2e-09 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 2e-07 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 1e-04 |
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
Score = 548 bits (1414), Expect = 0.0
Identities = 217/286 (75%), Positives = 251/286 (87%), Gaps = 7/286 (2%)
Query: 1 MEILKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMS----NI 56
ME LKK+FQEFI GLMSLPI +PG++LYRSLQAKK+M +L+++II+ KR +
Sbjct: 170 MEFLKKEFQEFIKGLMSLPIKLPGTRLYRSLQAKKRMVKLVKKIIEEKRRAMKNKEEDET 229
Query: 57 NVPKDVIDVLMMNNASDQPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQ 116
+PKDV+DVL+ + SD+ LTDDLI+DNMIDMMIPGEDSVPVLMTLAVK+LSD P ALQQ
Sbjct: 230 GIPKDVVDVLL-RDGSDE-LTDDLISDNMIDMMIPGEDSVPVLMTLAVKFLSDCPVALQQ 287
Query: 117 LTDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGY 176
LT+EN+KLK LKA GEPL W+DY+SLPFTQNVITETLRMGNII GVMRKAM+D+EIKGY
Sbjct: 288 LTEENMKLKRLKADTGEPLYWTDYMSLPFTQNVITETLRMGNIINGVMRKAMKDVEIKGY 347
Query: 177 LIPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDISNSSFTPFGGGQRLCPGLDLA 236
LIPKGWC AYFRSVHLDE NY+ PYQFNPWRWQ+ KD++NSSFTPFGGGQRLCPGLDLA
Sbjct: 348 LIPKGWCVLAYFRSVHLDEENYDNPYQFNPWRWQE-KDMNNSSFTPFGGGQRLCPGLDLA 406
Query: 237 RLEASIFLHHLVTQFRWVAEEDTVVNFPTVRMKRRMPIWVKKREDY 282
RLEASIFLHHLVT+FRWVAEEDT+VNFPTVRMKR++PIWV + +D
Sbjct: 407 RLEASIFLHHLVTRFRWVAEEDTIVNFPTVRMKRKLPIWVTRIDDS 452
|
Length = 452 |
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| PLN02774 | 463 | brassinosteroid-6-oxidase | 100.0 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 100.0 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 100.0 | |
| KOG0156 | 489 | consensus Cytochrome P450 CYP2 subfamily [Secondar | 100.0 | |
| KOG0158 | 499 | consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf | 100.0 | |
| KOG0159 | 519 | consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 | 100.0 | |
| KOG0684 | 486 | consensus Cytochrome P450 [Secondary metabolites b | 100.0 | |
| KOG0157 | 497 | consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami | 100.0 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 100.0 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 100.0 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 100.0 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 100.0 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 100.0 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 100.0 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 100.0 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 100.0 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 100.0 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 100.0 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 100.0 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 100.0 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 100.0 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 100.0 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 100.0 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 100.0 | |
| PLN02655 | 466 | ent-kaurene oxidase | 100.0 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 100.0 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 100.0 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 100.0 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 100.0 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 100.0 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 100.0 | |
| PLN02648 | 480 | allene oxide synthase | 100.0 |
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-53 Score=386.83 Aligned_cols=270 Identities=40% Similarity=0.766 Sum_probs=230.5
Q ss_pred HHHHHHHHHHhhhccCccCCCchhHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCcccHHHHHHhccCCCCCCCHHHHHH
Q 023238 4 LKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPKDVIDVLMMNNASDQPLTDDLIAD 83 (285)
Q Consensus 4 ~~~~f~~~~~~~~~~~~~lp~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~d~l~~ll~~~~~~~~l~~~~i~~ 83 (285)
+.+.+..+......+|.++|.+.+++..++++.+.+++.+.|+++++... ..+|+++.++...+.+..++++++.+
T Consensus 192 ~~~~~~~~~~~~~~~~~~lp~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~----~~~d~l~~ll~~~~~~~~~s~~ei~~ 267 (463)
T PLN02774 192 FKTEFFKLVLGTLSLPIDLPGTNYRSGVQARKNIVRMLRQLIQERRASGE----THTDMLGYLMRKEGNRYKLTDEEIID 267 (463)
T ss_pred HHHHHHHHhcccccCCcCCCChhhhHHHHHHHHHHHHHHHHHHHHHhcCC----CcccHHHHHHhCccCCCCCCHHHHHH
Confidence 33455555544555677888877778888999999999999999886532 25799999997543234589999999
Q ss_pred HHHHHHhcccchHHHHHHHHHHHHhhChHHHHHHHHHHHHHHHhhhhcCCCCChhccCCChhhHHHHhhhhcCCCCcccc
Q 023238 84 NMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQLTDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGV 163 (285)
Q Consensus 84 ~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~p~~~~~ 163 (285)
.+..+++||+|||+++++|++++|++||++|+++++|++++.+... ....++.+++.++||++|||+|++|++|+++..
T Consensus 268 ~~~~ll~Ag~dTt~~~l~w~l~~L~~~P~~q~kl~~Ei~~~~~~~~-~~~~~~~~~l~~lpyl~a~ikE~lRl~P~v~~~ 346 (463)
T PLN02774 268 QIITILYSGYETVSTTSMMAVKYLHDHPKALQELRKEHLAIRERKR-PEDPIDWNDYKSMRFTRAVIFETSRLATIVNGV 346 (463)
T ss_pred HHHHHHHhcchhHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHhccC-CCCCCCHHHHhcCcHHHHHHHHHHhcCCCCCCc
Confidence 9999999999999999999999999999999999999999875211 134689999999999999999999999999988
Q ss_pred cccccccceecCEEeCCCCEEeeeccccccCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCccHHHHHHHHHHH
Q 023238 164 MRKAMRDIEIKGYLIPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDISNSSFTPFGGGQRLCPGLDLARLEASIF 243 (285)
Q Consensus 164 ~r~~~~d~~i~g~~Ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~ 243 (285)
+|.+.+|++++||.||||+.|+++.+++||||++|+||++|+||||++........++|||+|+|.|+|++||.+|++++
T Consensus 347 ~R~~~~d~~l~g~~IpkGt~v~~~~~~~~rdp~~~~dP~~F~PeRfl~~~~~~~~~~lpFG~G~r~C~G~~~A~~e~~~~ 426 (463)
T PLN02774 347 LRKTTQDMELNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLDKSLESHNYFFLFGGGTRLCPGKELGIVEISTF 426 (463)
T ss_pred ccccCCCeeECCEEECCCCEEEEehHHhcCCcccCCChhccCchhcCCCCcCCCccccCcCCCCCcCCcHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999754322356899999999999999999999999
Q ss_pred HHHHHHhCee-cccCCccccCcccccCCCceEEEEe
Q 023238 244 LHHLVTQFRW-VAEEDTVVNFPTVRMKRRMPIWVKK 278 (285)
Q Consensus 244 l~~ll~~f~~-~~~~~~~~~~~~~~~~~~~~v~~~~ 278 (285)
++.|+++|+| +.++......+++.++++++|++++
T Consensus 427 la~Ll~~f~~~~~~~~~~~~~~~~~p~~g~~~~~~~ 462 (463)
T PLN02774 427 LHYFVTRYRWEEVGGDKLMKFPRVEAPNGLHIRVSP 462 (463)
T ss_pred HHHHHHhceEEECCCCccccCCCCCCCCCceEEeee
Confidence 9999999999 6555444555677788999999974
|
|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 285 | ||||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 9e-25 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 3e-18 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 3e-18 | ||
| 3dbg_A | 467 | Crystal Structure Of Cytochrome P450 170a1 (Cyp170a | 1e-17 | ||
| 1po5_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 Length = | 3e-17 | ||
| 3tk3_A | 476 | Cytochrome P450 2b4 Mutant L437a In Complex With 4- | 3e-17 | ||
| 1suo_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 With Bou | 5e-17 | ||
| 2q6n_A | 478 | Structure Of Cytochrome P450 2b4 With Bound 1-(4- C | 6e-17 | ||
| 4h1n_A | 479 | Crystal Structure Of P450 2b4 F297a Mutant In Compl | 7e-17 | ||
| 3qm4_A | 479 | Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl | 3e-16 | ||
| 2f9q_A | 479 | Crystal Structure Of Human Cytochrome P450 2d6 Leng | 8e-16 | ||
| 2p85_A | 476 | Structure Of Human Lung Cytochrome P450 2a13 With I | 4e-15 | ||
| 3qz1_A | 496 | Crystal Structure Of Bovine Steroid Of 21-Hydroxyla | 4e-15 | ||
| 1pq2_A | 476 | Crystal Structure Of Human Drug Metabolizing Cytoch | 2e-14 | ||
| 3ebs_A | 476 | Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C | 2e-14 | ||
| 1z10_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 With | 5e-14 | ||
| 2pg6_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 L240 | 8e-14 | ||
| 2pg5_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 8e-14 | ||
| 2pg7_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 1e-13 | ||
| 3ibd_A | 476 | Crystal Structure Of A Cytochrome P450 2b6 Genetic | 4e-13 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 4e-13 | ||
| 3hf2_A | 482 | Crystal Structure Of The I401p Mutant Of Cytochrome | 7e-13 | ||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 7e-13 | ||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 8e-13 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 8e-13 | ||
| 1dt6_A | 473 | Structure Of Mammalian Cytochrome P450 2c5 Length = | 1e-12 | ||
| 2x2n_A | 475 | X-Ray Structure Of Cyp51 From Trypanosoma Brucei In | 2e-12 | ||
| 3e4e_A | 476 | Human Cytochrome P450 2e1 In Complex With The Inhib | 2e-12 | ||
| 1r9o_A | 477 | Crystal Structure Of P4502c9 With Flurbiprofen Boun | 3e-12 | ||
| 3tik_A | 454 | Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom | 3e-12 | ||
| 1og2_A | 475 | Structure Of Human Cytochrome P450 Cyp2c9 Length = | 3e-12 | ||
| 3gw9_A | 450 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 3e-12 | ||
| 3p99_A | 453 | Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma | 3e-12 | ||
| 3g1q_A | 450 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 3e-12 | ||
| 2wv2_A | 475 | X-Ray Structure Of Cyp51 From The Human Pathogen Tr | 3e-12 | ||
| 1zoa_A | 473 | Crystal Structure Of A328v Mutant Of The Heme Domai | 5e-12 | ||
| 4duc_A | 472 | Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng | 7e-12 | ||
| 4duf_A | 471 | Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto | 7e-12 | ||
| 3kx4_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 7e-12 | ||
| 4dud_A | 471 | Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le | 7e-12 | ||
| 3cbd_A | 455 | Directed Evolution Of Cytochrome P450 Bm3, To Octan | 9e-12 | ||
| 2hpd_A | 471 | Crystal Structure Of Hemoprotein Domain Of P450bm-3 | 1e-11 | ||
| 2nnb_A | 471 | The Q403k Mutnat Heme Domain Of Flavocytochrome P45 | 1e-11 | ||
| 1fah_A | 471 | Structure Of Cytochrome P450 Length = 471 | 1e-11 | ||
| 2ij2_A | 470 | Atomic Structure Of The Heme Domain Of Flavocytochr | 1e-11 | ||
| 2x7y_A | 455 | P450 Bm3 F87a In Complex With Dmso Length = 455 | 1e-11 | ||
| 3dgi_A | 461 | Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le | 1e-11 | ||
| 3ben_A | 470 | Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine | 1e-11 | ||
| 2uwh_A | 458 | Cytochrome P450 Bm3 Mutant In Complex With Palmitic | 1e-11 | ||
| 1jpz_A | 473 | Crystal Structure Of A Complex Of The Heme Domain O | 1e-11 | ||
| 3kx3_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 1e-11 | ||
| 1bvy_A | 458 | Complex Of The Heme And Fmn-Binding Domains Of The | 1e-11 | ||
| 1yqo_A | 455 | T268a Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-11 | ||
| 1smi_A | 471 | A Single Mutation Of P450 Bm3 Induces The Conformat | 1e-11 | ||
| 2ij4_A | 470 | Structure Of The A264k Mutant Of Cytochrome P450 Bm | 1e-11 | ||
| 3qi8_B | 472 | Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) | 1e-11 | ||
| 2bmh_A | 455 | Modeling Protein-Substrate Interactions In The Heme | 1e-11 | ||
| 3npl_A | 470 | Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D | 1e-11 | ||
| 3ekf_A | 470 | Crystal Structure Of The A264q Heme Domain Of Cytoc | 2e-11 | ||
| 2ij3_A | 470 | Structure Of The A264h Mutant Of Cytochrome P450 Bm | 2e-11 | ||
| 3ekb_A | 470 | Crystal Structure Of The A264c Mutant Heme Domain O | 2e-11 | ||
| 1zo4_A | 473 | Crystal Structure Of A328s Mutant Of The Heme Domai | 2e-11 | ||
| 1yqp_A | 455 | T268n Mutant Cytochrome Domain Of Flavocytochrome P | 2e-11 | ||
| 3kx5_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 2e-11 | ||
| 3ekd_A | 470 | Crystal Structure Of The A264m Heme Domain Of Cytoc | 2e-11 | ||
| 3m4v_A | 482 | Crystal Structure Of The A330p Mutant Of Cytochrome | 3e-11 | ||
| 1p0x_A | 455 | F393y Mutant Heme Domain Of Flavocytochrome P450 Bm | 3e-11 | ||
| 4dtw_B | 469 | Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto | 6e-11 | ||
| 3l4d_A | 453 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 7e-11 | ||
| 1p0w_A | 455 | F393w Mutant Heme Domain Of Flavocytochrome P450 Bm | 8e-11 | ||
| 1jme_A | 455 | Crystal Structure Of Phe393his Cytochrome P450 Bm3 | 9e-11 | ||
| 4dub_A | 472 | Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami | 9e-11 | ||
| 4i8v_A | 491 | Human Cytochrome P450 1a1 In Complex With Alpha-nap | 1e-10 | ||
| 4dua_A | 471 | Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng | 1e-10 | ||
| 1p0v_A | 455 | F393a Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-10 | ||
| 3psx_A | 487 | Crystal Structure Of The Kt2 Mutant Of Cytochrome P | 2e-10 | ||
| 4du2_B | 470 | Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin | 2e-10 | ||
| 2q9f_A | 456 | Crystal Structure Of Human Cytochrome P450 46a1 In | 5e-10 | ||
| 1q5d_A | 419 | Epothilone B-Bound Cytochrome P450epok Length = 419 | 1e-09 | ||
| 1pkf_A | 419 | Crystal Structure Of Epothilone D-Bound Cytochrome | 1e-09 | ||
| 3mzs_A | 486 | Crystal Structure Of Cytochrome P450 Cyp11a1 In Com | 3e-09 | ||
| 2hi4_A | 495 | Crystal Structure Of Human Microsomal P450 1a2 In C | 3e-09 | ||
| 3k1o_A | 458 | Crystal Structure Of Sterol 14-alpha Demethylase (c | 4e-09 | ||
| 2wuz_A | 473 | X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In | 4e-09 | ||
| 3khm_A | 464 | Crystal Structure Of Sterol 14alpha-Demethylase (Cy | 5e-09 | ||
| 3k9v_A | 482 | Crystal Structure Of Rat Mitochondrial P450 24a1 S5 | 9e-09 | ||
| 1x8v_A | 455 | Estriol-Bound And Ligand-Free Structures Of Sterol | 1e-08 | ||
| 1ea1_A | 455 | Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) | 1e-08 | ||
| 2w0a_A | 455 | Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( | 1e-08 | ||
| 1u13_A | 455 | Crystal Structure Analysis Of The C37lC151TC442A-Tr | 1e-08 | ||
| 3mgx_A | 415 | Crystal Structure Of P450 Oxyd That Is Involved In | 2e-08 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 7e-08 | ||
| 3na0_A | 471 | Crystal Structure Of Human Cyp11a1 In Complex With | 8e-08 | ||
| 3n9y_A | 487 | Crystal Structure Of Human Cyp11a1 In Complex With | 9e-08 | ||
| 3eqm_A | 503 | Crystal Structure Of Human Placental Aromatase Cyto | 1e-07 | ||
| 1gwi_A | 411 | The 1.92 A Structure Of Streptomyces Coelicolor A3( | 1e-07 | ||
| 3aba_A | 403 | Crystal Structure Of Cyp105p1 In Complex With Filip | 2e-07 | ||
| 3e5j_A | 403 | Crystal Structure Of Cyp105p1 Wild-type Ligand-free | 2e-07 | ||
| 3e5l_A | 403 | Crystal Structure Of Cyp105p1 H72a Mutant Length = | 2e-07 | ||
| 3r9c_A | 418 | Crystal Structure Of Mycobacterium Smegmatis Cyp164 | 3e-07 | ||
| 1cpt_A | 428 | Crystal Structure And Refinement Of Cytochrome P450 | 1e-06 | ||
| 1ue8_A | 367 | Crystal Structure Of Thermophilic Cytochrome P450 F | 2e-06 | ||
| 4dvq_A | 483 | Structure Of Human Aldosterone Synthase, Cyp11b2, I | 3e-06 | ||
| 4apy_A | 433 | Ethylene Glycol-bound Form Of P450 Cyp125a3 From My | 4e-06 | ||
| 2x5l_A | 431 | X-Ray Structure Of The Substrate-Free Mycobacterium | 5e-06 | ||
| 2xc3_A | 424 | X-Ray Structure Of Mycobacterium Tuberculosis Cyp12 | 5e-06 | ||
| 3ejb_B | 404 | Crystal Structure Of P450bioi In Complex With Tetra | 5e-06 | ||
| 2xn8_A | 423 | X-Ray Structure Of The Substrate-Free Mycobacterium | 5e-06 | ||
| 2x5w_A | 440 | X-Ray Structure Of Mycobacterium Tuberculosis Cytoc | 5e-06 | ||
| 3ivy_A | 433 | Crystal Structure Of Mycobacterium Tuberculosis Cyt | 5e-06 | ||
| 3tkt_A | 450 | Crystal Structure Of Cyp108d1 From Novosphingobium | 6e-06 | ||
| 2wm4_A | 435 | X-Ray Structure Of Mycobacterium Tuberculosis Cytoc | 7e-06 | ||
| 3pm0_A | 507 | Structural Characterization Of The Complex Between | 1e-05 | ||
| 3lxh_A | 421 | Crystal Structure Of Cytochrome P450 Cyp101d1 Lengt | 2e-05 | ||
| 3ruk_A | 494 | Human Cytochrome P450 Cyp17a1 In Complex With Abira | 3e-05 | ||
| 2vrv_A | 431 | Structure Of Histidine Tagged Cytochrome P450 Eryk | 3e-05 | ||
| 2jjn_A | 411 | Structure Of Closed Cytochrome P450 Eryk Length = 4 | 4e-05 | ||
| 3tyw_A | 417 | Crystal Structure Of Cyp105n1 From Streptomyces Coe | 4e-05 | ||
| 3dax_A | 491 | Crystal Structure Of Human Cyp7a1 Length = 491 | 8e-05 | ||
| 3sn5_A | 491 | Crystal Structure Of Human Cyp7a1 In Complex With C | 9e-05 | ||
| 1n97_A | 389 | Crystal Stucture Of Cyp175a1 From Thermus Thermophi | 2e-04 | ||
| 1f4t_A | 368 | Thermophilic P450: Cyp119 From Sulfolobus Solfactar | 3e-04 | ||
| 2fr7_A | 412 | Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt | 3e-04 | ||
| 1io8_A | 368 | Thermophilic Cytochrome P450 (Cyp119) From Sulfolob | 3e-04 | ||
| 2rfb_A | 343 | Crystal Structure Of A Cytochrome P450 From The The | 3e-04 | ||
| 4ep6_A | 392 | Crystal Structure Of The Xpla Heme Domain In Comple | 3e-04 | ||
| 2wiv_A | 394 | Cytochrome-P450 Xpla Heme Domain P21 Length = 394 | 3e-04 | ||
| 1wiy_A | 389 | Crystal Structure Analysis Of A 6-Coordinated Cytoc | 4e-04 | ||
| 4dnz_A | 410 | The Crystal Structures Of Cyp199a4 Length = 410 | 4e-04 | ||
| 2d0e_A | 407 | Substrate Assited In Oxygen Activation In Cytochrom | 6e-04 | ||
| 1s1f_A | 406 | Crystal Structure Of Streptomyces Coelicolor A3(2) | 6e-04 | ||
| 3tzo_A | 410 | The Role Of I87 Of Cyp158a2 In Oxidative Coupling R | 6e-04 | ||
| 1se6_A | 406 | Crystal Structure Of Streptomyces Coelicolor A3(2) | 6e-04 | ||
| 3tnk_A | 407 | Crystal Structure Of Mutant I87r In Cyp158a2 Length | 6e-04 | ||
| 1t93_A | 406 | Evidence For Multiple Substrate Recognition And Mol | 7e-04 | ||
| 2d09_A | 407 | A Role For Active Site Water Molecules And Hydroxyl | 7e-04 |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
|
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 | Back alignment and structure |
| >pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 | Back alignment and structure |
| >pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 | Back alignment and structure |
| >pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 | Back alignment and structure |
| >pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 | Back alignment and structure |
| >pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 | Back alignment and structure |
| >pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 | Back alignment and structure |
| >pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 | Back alignment and structure |
| >pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 | Back alignment and structure |
| >pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 | Back alignment and structure |
| >pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 | Back alignment and structure |
| >pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 | Back alignment and structure |
| >pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 | Back alignment and structure |
| >pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 | Back alignment and structure |
| >pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 | Back alignment and structure |
| >pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 | Back alignment and structure |
| >pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 | Back alignment and structure |
| >pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 | Back alignment and structure |
| >pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 | Back alignment and structure |
| >pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 | Back alignment and structure |
| >pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 | Back alignment and structure |
| >pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 | Back alignment and structure |
| >pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 | Back alignment and structure |
| >pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 | Back alignment and structure |
| >pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 | Back alignment and structure |
| >pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 | Back alignment and structure |
| >pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 | Back alignment and structure |
| >pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 | Back alignment and structure |
| >pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 | Back alignment and structure |
| >pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 | Back alignment and structure |
| >pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 | Back alignment and structure |
| >pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 | Back alignment and structure |
| >pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 | Back alignment and structure |
| >pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 | Back alignment and structure |
| >pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 | Back alignment and structure |
| >pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 | Back alignment and structure |
| >pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 | Back alignment and structure |
| >pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 | Back alignment and structure |
| >pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 | Back alignment and structure |
| >pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 | Back alignment and structure |
| >pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 | Back alignment and structure |
| >pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 | Back alignment and structure |
| >pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 | Back alignment and structure |
| >pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 | Back alignment and structure |
| >pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 | Back alignment and structure |
| >pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 | Back alignment and structure |
| >pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 | Back alignment and structure |
| >pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 | Back alignment and structure |
| >pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 | Back alignment and structure |
| >pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 | Back alignment and structure |
| >pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 | Back alignment and structure |
| >pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 | Back alignment and structure |
| >pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 | Back alignment and structure |
| >pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 | Back alignment and structure |
| >pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 | Back alignment and structure |
| >pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 | Back alignment and structure |
| >pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 | Back alignment and structure |
| >pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 | Back alignment and structure |
| >pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 | Back alignment and structure |
| >pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 | Back alignment and structure |
| >pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 | Back alignment and structure |
| >pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 | Back alignment and structure |
| >pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 | Back alignment and structure |
| >pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 | Back alignment and structure |
| >pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 | Back alignment and structure |
| >pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 | Back alignment and structure |
| >pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 | Back alignment and structure |
| >pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 | Back alignment and structure |
| >pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 | Back alignment and structure |
| >pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 | Back alignment and structure |
| >pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 | Back alignment and structure |
| >pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 | Back alignment and structure |
| >pdb|4APY|A Chain A, Ethylene Glycol-bound Form Of P450 Cyp125a3 From Mycobacterium Smegmatis Length = 433 | Back alignment and structure |
| >pdb|2X5L|A Chain A, X-Ray Structure Of The Substrate-Free Mycobacterium Tuberculosis Cytochrome P450 Cyp125, Alternative Crystal Form Length = 431 | Back alignment and structure |
| >pdb|2XC3|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cyp125 Bound To The Reverse Type I Inhibitor Length = 424 | Back alignment and structure |
| >pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 | Back alignment and structure |
| >pdb|2XN8|A Chain A, X-Ray Structure Of The Substrate-Free Mycobacterium Tuberculosis Cytochrome P450 Cyp125 Length = 423 | Back alignment and structure |
| >pdb|2X5W|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp125 In Complex With Substrate Cholest-4-En-3-One Length = 440 | Back alignment and structure |
| >pdb|3IVY|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp125, P212121 Crystal Form Length = 433 | Back alignment and structure |
| >pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 | Back alignment and structure |
| >pdb|2WM4|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp124 In Complex With Phytanic Acid Length = 435 | Back alignment and structure |
| >pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 | Back alignment and structure |
| >pdb|3LXH|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101d1 Length = 421 | Back alignment and structure |
| >pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 | Back alignment and structure |
| >pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 | Back alignment and structure |
| >pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 | Back alignment and structure |
| >pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 | Back alignment and structure |
| >pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 | Back alignment and structure |
| >pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 | Back alignment and structure |
| >pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 | Back alignment and structure |
| >pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 | Back alignment and structure |
| >pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 | Back alignment and structure |
| >pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 | Back alignment and structure |
| >pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 | Back alignment and structure |
| >pdb|4EP6|A Chain A, Crystal Structure Of The Xpla Heme Domain In Complex With Imidazole And Peg Length = 392 | Back alignment and structure |
| >pdb|2WIV|A Chain A, Cytochrome-P450 Xpla Heme Domain P21 Length = 394 | Back alignment and structure |
| >pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 | Back alignment and structure |
| >pdb|4DNZ|A Chain A, The Crystal Structures Of Cyp199a4 Length = 410 | Back alignment and structure |
| >pdb|2D0E|A Chain A, Substrate Assited In Oxygen Activation In Cytochrome P450 158a2 Length = 407 | Back alignment and structure |
| >pdb|1S1F|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 | Back alignment and structure |
| >pdb|3TZO|A Chain A, The Role Of I87 Of Cyp158a2 In Oxidative Coupling Reaction Length = 410 | Back alignment and structure |
| >pdb|1SE6|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 | Back alignment and structure |
| >pdb|3TNK|A Chain A, Crystal Structure Of Mutant I87r In Cyp158a2 Length = 407 | Back alignment and structure |
| >pdb|1T93|A Chain A, Evidence For Multiple Substrate Recognition And Molecular Mechanism Of C-C Reaction By Cytochrome P450 Cyp158a2 From Streptomyces Coelicolor A3(2) Length = 406 | Back alignment and structure |
| >pdb|2D09|A Chain A, A Role For Active Site Water Molecules And Hydroxyl Groups Of Substrate For Oxygen Activation In Cytochrome P450 158a2 Length = 407 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 1e-104 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 3e-60 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 2e-55 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 4e-55 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 2e-54 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 1e-51 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 6e-49 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 4e-47 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 6e-47 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 1e-40 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 4e-38 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 6e-35 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 1e-34 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 7e-33 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 1e-32 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 3e-32 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 4e-32 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 8e-32 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 2e-30 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 2e-30 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 7e-30 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 1e-29 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 7e-29 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 9e-29 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 2e-27 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 9e-26 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 1e-25 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 1e-21 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 3e-21 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 4e-19 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 2e-18 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 5e-18 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 3e-17 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 4e-17 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 9e-17 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 1e-16 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 2e-16 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 2e-16 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 7e-16 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 1e-15 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 2e-15 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 5e-15 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 2e-14 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 2e-14 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 5e-14 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 5e-14 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 8e-14 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 2e-13 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 3e-13 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 8e-13 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 8e-13 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 1e-12 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 1e-12 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 2e-11 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 2e-11 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 3e-11 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 5e-11 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 8e-11 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 8e-11 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 9e-11 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 1e-10 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 1e-10 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 1e-10 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 1e-10 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 2e-10 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 2e-10 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 2e-10 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 3e-10 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 3e-10 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 4e-10 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 4e-10 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 5e-10 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 5e-10 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 1e-09 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 |
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
Score = 310 bits (796), Expect = e-104
Identities = 70/284 (24%), Positives = 132/284 (46%), Gaps = 20/284 (7%)
Query: 4 LKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPKDVI 63
L F+ +I GL SLPI +P + +S +A+ + +++II++++ S +D +
Sbjct: 170 LFPWFETYIQGLFSLPIPLPNTLFGKSQRARALLLAELEKIIKARQQQPPS----EEDAL 225
Query: 64 DVLMMNNASD---QPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQLTDE 120
+L+ A D QPL+ + D ++ ++ G +++ ++ L + +++ E
Sbjct: 226 GILL--AARDDNNQPLSLPELKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQE 283
Query: 121 NIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPK 180
KL+ + L+ +P+ V+ E LR+ + G R+ ++D + +G+ PK
Sbjct: 284 QNKLQL-----SQELTAETLKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPK 338
Query: 181 GWCFFAYFRSVHLDESNYEWPYQFNPWRWQDN---KDISNSSFTPFGGGQRLCPGLDLAR 237
GW H D Y P +F+P R+ + + PFGGG R C G + AR
Sbjct: 339 GWLVSYQISQTHADPDLYPDPEKFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFAR 398
Query: 238 LEASIFLHHLVTQFRWV---AEEDTVVNFPTVRMKRRMPIWVKK 278
LE +F L+ QF W + +V P+ R K + + +
Sbjct: 399 LEMKLFATRLIQQFDWTLLPGQNLELVVTPSPRPKDNLRVKLHS 442
|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 100.0 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 100.0 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 100.0 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 100.0 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 100.0 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 100.0 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 100.0 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 100.0 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 100.0 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 100.0 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 100.0 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 100.0 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 100.0 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 100.0 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 100.0 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 100.0 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 100.0 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 100.0 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 100.0 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 100.0 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 100.0 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 100.0 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 100.0 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 100.0 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 100.0 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 100.0 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 100.0 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 100.0 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 100.0 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 100.0 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 100.0 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 100.0 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 100.0 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 100.0 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 100.0 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 100.0 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 100.0 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 100.0 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 100.0 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 100.0 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 100.0 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 100.0 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 100.0 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 100.0 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 100.0 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 100.0 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 100.0 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 100.0 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 100.0 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 100.0 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 100.0 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 100.0 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 100.0 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 100.0 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 100.0 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 100.0 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 100.0 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 100.0 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 100.0 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 100.0 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 100.0 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 100.0 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 100.0 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 100.0 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 100.0 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 100.0 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 100.0 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 100.0 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 100.0 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 100.0 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 100.0 |
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.5e-54 Score=390.08 Aligned_cols=258 Identities=21% Similarity=0.307 Sum_probs=227.6
Q ss_pred ccCccCCCchhHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCcccHHHHHHhccC-CCCCCCHHHHHHHHHHHHhcccch
Q 023238 17 SLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPKDVIDVLMMNNA-SDQPLTDDLIADNMIDMMIPGEDS 95 (285)
Q Consensus 17 ~~~~~lp~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~d~l~~ll~~~~-~~~~l~~~~i~~~~~~~~~ag~~t 95 (285)
.+|.|+|.+.+.+..++.+++.+++.+.|++++.+.+ ..+|+++.|++... ++..++++++...+..+++||+||
T Consensus 192 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~r~~~~~----~~~d~l~~ll~~~~~~~~~ls~~ei~~~~~~~~~aG~dT 267 (461)
T 3ld6_A 192 LLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQE----KIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 267 (461)
T ss_dssp HSCTTSCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCC----CCCSHHHHHHTCBCTTSCBCCHHHHHHHHHHHHHHHHHH
T ss_pred hhhhhccCcHHHHHHHHHHHHHHHHHHHHHHHHhcCC----CCcchhhhhHHhhhcccCCCCHHHHHHHHHhhhhccccc
Confidence 3688899998999999999999999999999887653 36799999997643 345799999999999999999999
Q ss_pred HHHHHHHHHHHHhhChHHHHHHHHHHHHHHHhhhhcCCCCChhccCCChhhHHHHhhhhcCCCCcccccccccccceecC
Q 023238 96 VPVLMTLAVKYLSDYPAALQQLTDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKG 175 (285)
Q Consensus 96 t~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~i~g 175 (285)
|+.+++|++++|+.||++|+++++|++.+++. ....++.+++.+||||+|||+|++|++|+++...|.+.+|++++|
T Consensus 268 t~~~l~~~l~~L~~~P~~q~kl~~Ei~~v~~~---~~~~~~~~~l~~lpyl~avi~E~lRl~p~~~~~~r~~~~d~~~~g 344 (461)
T 3ld6_A 268 SSTTSAWMGFFLARDKTLQKKCYLEQKTVCGE---NLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAG 344 (461)
T ss_dssp HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHCT---TCCCCCHHHHHTCHHHHHHHHHHHHHSCSCCCEEEEESSCEEETT
T ss_pred ccccchhhhcccccChHHHHHHHHHHHHHhcc---cccchhHHHHHHHhhhhheeeeccccCCchhccccccccceeeCC
Confidence 99999999999999999999999999999863 445688999999999999999999999999988999999999999
Q ss_pred EEeCCCCEEeeeccccccCCCCCCCCCCCCCCCCCCCCCC--CCCCccccCCCCCCCccHHHHHHHHHHHHHHHHHhCee
Q 023238 176 YLIPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDI--SNSSFTPFGGGQRLCPGLDLARLEASIFLHHLVTQFRW 253 (285)
Q Consensus 176 ~~Ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~~~~~~~--~~~~~~~Fg~G~r~C~G~~~A~~~~~~~l~~ll~~f~~ 253 (285)
|.||||+.|+++.+++||||++|+||++|+||||+++... ....|+|||+|+|.|+|++||.+|++++++.|+++|+|
T Consensus 345 ~~ip~Gt~v~~~~~~~~~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~r~C~G~~lA~~e~~~~la~ll~~f~~ 424 (461)
T 3ld6_A 345 YTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEF 424 (461)
T ss_dssp EEECTTCEEEECHHHHTTCTTTCTTTTSCCGGGGGSCCHHHHSSSSSCTTCCGGGCCSCHHHHHHHHHHHHHHHHHHEEE
T ss_pred cccCCCCeeeechHhhcCCccccCCccccCccccCCCCcccCCCCccccCCCcCcCChhHHHHHHHHHHHHHHHHHhCEE
Confidence 9999999999999999999999999999999999976532 23789999999999999999999999999999999999
Q ss_pred -cccCC--ccccCcccccCCCceEEEEeccC
Q 023238 254 -VAEED--TVVNFPTVRMKRRMPIWVKKRED 281 (285)
Q Consensus 254 -~~~~~--~~~~~~~~~~~~~~~v~~~~r~~ 281 (285)
+.++. .........++.+++|++++|+-
T Consensus 425 ~l~~~~~~~~~~~~~~~~p~~~~v~~~~Rss 455 (461)
T 3ld6_A 425 DLIDGYFPTVNYTTMIHTPENPVIRYKRRST 455 (461)
T ss_dssp ECSTTCCCCBCCSSSSCCBSSCEEEEEECC-
T ss_pred EeCCCCCCcccccceEEcCCceEEEEEECCC
Confidence 55432 22333455667789999999974
|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 285 | ||||
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 3e-33 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 1e-27 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 3e-27 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 9e-24 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 3e-21 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 2e-20 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 4e-19 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 5e-19 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 6e-19 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 9e-19 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 9e-18 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 3e-17 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 5e-17 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 1e-16 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 3e-16 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 4e-16 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 4e-16 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 2e-15 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 1e-14 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 5e-14 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 9e-13 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Score = 124 bits (311), Expect = 3e-33
Identities = 55/286 (19%), Positives = 124/286 (43%), Gaps = 17/286 (5%)
Query: 8 FQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPKDVIDVLM 67
F + P IP ++ +++ +++ ++ ++ + + + LM
Sbjct: 189 LDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLM 248
Query: 68 MN------NASDQPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQLTDEN 121
++ S + L+D + I + G ++ +++ + L+ +P Q+L +E
Sbjct: 249 IDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEI 308
Query: 122 IKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKG 181
+ K P ++ L + + V+ ETLR+ I + + R +D+EI G IPKG
Sbjct: 309 DAVLPNK----APPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKG 364
Query: 182 WCFFAYFRSVHLDESNYEWPYQFNPWRW--QDNKDISNSSFTPFGGGQRLCPGLDLARLE 239
++H D + P +F P R+ ++ +I +TPFG G R C G+ A +
Sbjct: 365 VVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMN 424
Query: 240 ASIFLHHLVTQFRWVAEEDTVVN-----FPTVRMKRRMPIWVKKRE 280
+ L ++ F + ++T + ++ ++ + + V+ R+
Sbjct: 425 MKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD 470
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 100.0 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 100.0 | |
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 100.0 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 100.0 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 100.0 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 100.0 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 100.0 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 100.0 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 100.0 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 100.0 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 100.0 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 100.0 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 100.0 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 100.0 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 100.0 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 100.0 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 100.0 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 100.0 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 100.0 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 100.0 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 100.0 |
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51) species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00 E-value=1.2e-52 Score=378.35 Aligned_cols=263 Identities=21% Similarity=0.326 Sum_probs=227.8
Q ss_pred HhhhccCccCCCchhHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCcccHHHHHHhccC--CCCCCCHHHHHHHHHHHHh
Q 023238 13 SGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPKDVIDVLMMNNA--SDQPLTDDLIADNMIDMMI 90 (285)
Q Consensus 13 ~~~~~~~~~lp~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~d~l~~ll~~~~--~~~~l~~~~i~~~~~~~~~ 90 (285)
..+..++.++|....++..++++++.+++.+++++++++...+ ...+|+++.|++... ....+++++++..++.+++
T Consensus 173 ~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~i~~~~~~~~~~-~~~~dll~~ll~~~~~~~~~~ls~~ei~~~~~~ll~ 251 (445)
T d2ciba1 173 DPLAYVDPYLPIESFRRRDEARNGLVALVADIMNGRIANPPTD-KSDRDMLDVLIAVKAETGTPRFSADEITGMFISMMF 251 (445)
T ss_dssp CGGGGTCTTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHCC------CCCHHHHHHHCBCTTSSBSCCHHHHHHHHHHHHH
T ss_pred hhhccccchhhhHHHHHHHHHHHHHHHHHHHHHhhhccccccc-ccccchhhhhhccccccccccCCcchhhhhhhhhhh
Confidence 3344567788998889999999999999999999988876543 346799999997642 2346899999999999999
Q ss_pred cccchHHHHHHHHHHHHhhChHHHHHHHHHHHHHHHhhhhcCCCCChhccCCChhhHHHHhhhhcCCCCccccccccccc
Q 023238 91 PGEDSVPVLMTLAVKYLSDYPAALQQLTDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRD 170 (285)
Q Consensus 91 ag~~tt~~~l~~~l~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d 170 (285)
||++||+.+++|++++|+.||++|+++++|++.+.+ .+..++.+++.+||||+++++|++|++|+++...|.+.+|
T Consensus 252 ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~----~~~~~~~~~l~~lp~L~a~i~E~lRl~p~~~~~~~~~~~~ 327 (445)
T d2ciba1 252 AGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYG----DGRSVSFHALRQIPQLENVLKETLRLHPPLIILMRVAKGE 327 (445)
T ss_dssp HHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGG----GCCCHHHHTTSCCHHHHHHHHHHHHHSCSCCCEEEEECSC
T ss_pred hccccchhhccccccccccccccccccccccccccc----ccccchhhhcccchhhccccccccccccccceeccccccc
Confidence 999999999999999999999999999999999986 5567899999999999999999999999999888999999
Q ss_pred ceecCEEeCCCCEEeeeccccccCCCCCCCCCCCCCCCCCCCCCC---CCCCccccCCCCCCCccHHHHHHHHHHHHHHH
Q 023238 171 IEIKGYLIPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDI---SNSSFTPFGGGQRLCPGLDLARLEASIFLHHL 247 (285)
Q Consensus 171 ~~i~g~~Ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~~~~~~~---~~~~~~~Fg~G~r~C~G~~~A~~~~~~~l~~l 247 (285)
+.++|+.||||+.|+++.+++|+||++|+||++|+||||++.... ....|+|||.|+|.|+|++||..+++++++.|
T Consensus 328 ~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~PeRf~~~~~~~~~~~~~~~pFG~G~r~C~G~~~A~~~~~~~la~l 407 (445)
T d2ciba1 328 FEVQGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFSVL 407 (445)
T ss_dssp EEETTEEECTTCEEEECHHHHTTCTTTSSSTTSCCGGGGSTTTCHHHHCTTTCCTTCCGGGCCTTHHHHHHHHHHHHHHH
T ss_pred cccceeeccccccccccccccccCcccCCChhhCCcccccCccccccCCCCcccCCCCCCccChhHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999875542 23789999999999999999999999999999
Q ss_pred HHhCee-cccC-Ccc--c-cCcccccCCCceEEEEecc
Q 023238 248 VTQFRW-VAEE-DTV--V-NFPTVRMKRRMPIWVKKRE 280 (285)
Q Consensus 248 l~~f~~-~~~~-~~~--~-~~~~~~~~~~~~v~~~~r~ 280 (285)
+++|+| +..+ +.. . ...+..++.+++|++++|+
T Consensus 408 l~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~Rs 445 (445)
T d2ciba1 408 LREYEFEMAQPPESYRNDHSKMVVQLAQPAAVRYRRRT 445 (445)
T ss_dssp HHHEEEEESSCGGGCCEECSSSSCEECSCCEEEEEEC-
T ss_pred HHhCEEEECCCCCccccccceEEEccCCCEEEEEEeCc
Confidence 999999 5543 221 1 1235677889999999996
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|