Citrus Sinensis ID: 023238

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MEILKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQSKRDGGMSNINVPKDVIDVLMMNNASDQPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQLTDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDISNSSFTPFGGGQRLCPGLDLARLEASIFLHHLVTQFRWVAEEDTVVNFPTVRMKRRMPIWVKKREDYKLT

cHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccHHHcccccHHHHHHHHHHcccccccccccEEcccEEEccEECccccEEEcccHHHcccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHHccEEECcccCEECcccccccccccEEEECccccccc

MEILKKQFQEFISGLMSLPINIPGSQLYRSLQAKKKMARLIQEIIQS*****MSNINVPKDVIDVLMMNNASDQPLTDDLIADNMIDMMIPGEDSVPVLMTLAVKYLSDYPAALQQLTDENIKLKELKAQLGEPLSWSDYLSLPFTQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKGWCFFAYFRSVHLDESNYEWPYQFNPWRWQDNKDISNSSFTPFGGGQRLCPGLDLARLEASIFLHHLVTQFRWVAEEDTVVNFPTVRMKRRMPIWVK********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome P450 90D2	May convert 6-deoxoteasterone to 3-dehydro-6-deoxoteasterone, and teasterone to 3-dehydroteasterone. Catalyzes the C6-oxidation step in brassinosteroids biosynthesis. Involved in the elongation of leaf sheaths and stems.	probable	Q94IW5

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VE3, chain A
Confidence level:very confident
Coverage over the Query: 4-279
View the alignment between query and template
View the model in PyMOL