Citrus Sinensis ID: 023250

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKGSLSPGGLLRGLSFKKKGIVSDGERSSLLSSDSQTSPGSPIIARITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccccHHHHHHHHccccccccccccc
ccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccHHHHHEEEEcccccccccEEEccccccHHHHHHHHHHHHHHHHccccEEEEcccEEEEccEEEEEEccccccccccccccccccccccc
mqadieiegpsnaetsnpgpsgrrpdlslqvpprplgfvssrtgrpslqsqrsykgslspggllrglsfkkkgivsdgerssllssdsqtspgspiIARITSAfswqrctslpvtpasnlspsistpasartsgeqhkankgtaptavsrslsvpgrniVIVRSvslptrrdhvqtdtsddqivpapmenndeeiAEEEAVCRICLDICeegntlkmecSCKGALRLVHEECAIRWfstkgnkncevcgkevqnlpVTLLRMsssaqrdnrrnhsqqtmhsrsvr
mqadieiegpsnaetsnpgpsgrrpdLSLQVPPRPLgfvssrtgrpslqsqrsykgslspggllrglsfKKKGIVsdgerssllssdsqtspgsPIIARITSAFSWQRCTSLpvtpasnlspsISTPASARTSgeqhkankgtaptavsrslsvpgrnivivrsvslptrrdhvqtdtsddqivpapMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFstkgnkncevcGKEVQNLPVTLLRmsssaqrdnrrnhsqqtmhsrsvr
MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKgslspggllrglsFKKKGIVsdgerssllssdsqtspgspIIARITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMenndeeiaeeeaVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVR
***********************************************************************************************IIARITSAFSWQRCTSL*********************************************NIVIVRS**********************************EAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLL*************************
*********************************************************************************************************************************************************************************************************CRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSS********************
***********************RPDLSLQVPPRPLGFVSSRT**************LSPGGLLRGLSFKKKGI*******************SPIIARITSAFSWQRCTSLPVTP********************************SRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMS**********************
************************************************************************************************************************************************************RNIVIVR*VSL**************************EIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSS*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKGSLSPGGLLRGLSFKKKGIVSDGERSSLLSSDSQTSPGSPIIARITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q3TZ87 348 E3 ubiquitin-protein liga yes no 0.196 0.160 0.403 2e-06
Q86YJ5 346 E3 ubiquitin-protein liga yes no 0.196 0.161 0.403 2e-06
Q0P496 421 E3 ubiquitin-protein liga no no 0.2 0.135 0.379 3e-06
A6P320 398 E3 ubiquitin-protein liga no no 0.221 0.158 0.328 1e-05
Q8CBH7 400 E3 ubiquitin-protein liga no no 0.221 0.157 0.328 2e-05
A6NNE9 402 E3 ubiquitin-protein liga no no 0.203 0.144 0.305 3e-05
Q5R9W1 910 E3 ubiquitin-protein liga no no 0.210 0.065 0.283 6e-05
Q6ZQ89 909 E3 ubiquitin-protein liga no no 0.210 0.066 0.283 6e-05
O60337 910 E3 ubiquitin-protein liga no no 0.210 0.065 0.283 6e-05
Q9P2E8 410 E3 ubiquitin-protein liga no no 0.2 0.139 0.327 7e-05
>sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 202 CRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVT 258
           CRIC    E+G  L   C C G++R  H+ C IRW S +G+ +CE+C  + Q L ++
Sbjct: 110 CRICFQGPEQGELLS-PCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAIS 165
E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 Back     alignment and function description
>sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 Back     alignment and function description
>sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 Back     alignment and function description
>sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 Back     alignment and function description
>sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 Back     alignment and function description
>sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 Back     alignment and function description
>sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 Back     alignment and function description
>sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Homo sapiens GN=MARCH4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
255551611 441 protein binding protein, putative [Ricin 0.975 0.630 0.658 3e-98
225432416 429 PREDICTED: uncharacterized protein LOC10 0.992 0.659 0.625 3e-93
356546476 410 PREDICTED: uncharacterized protein LOC10 0.957 0.665 0.632 3e-91
356555575 422 PREDICTED: uncharacterized protein LOC10 0.950 0.642 0.624 5e-89
449454458 423 PREDICTED: uncharacterized protein LOC10 0.985 0.664 0.611 2e-85
224102537359 predicted protein [Populus trichocarpa] 0.936 0.743 0.611 8e-83
357447501 424 E3 ubiquitin-protein ligase MARCH1 [Medi 0.954 0.641 0.590 2e-81
255631544254 unknown [Glycine max] 0.8 0.897 0.639 3e-74
21594296 424 unknown [Arabidopsis thaliana] 0.905 0.608 0.526 3e-56
145331984363 RING/U-box domain-containing protein [Ar 0.905 0.710 0.526 4e-56
>gi|255551611|ref|XP_002516851.1| protein binding protein, putative [Ricinus communis] gi|223543939|gb|EEF45465.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 187/284 (65%), Positives = 225/284 (79%), Gaps = 6/284 (2%)

Query: 1   MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKGSLSP 60
           MQAD+++  PSN E SNPGP+ +R DL +QVPPRP+GF  SR+G+  + SQ S KGS S 
Sbjct: 1   MQADLKLAEPSNGEISNPGPNTKRSDLLVQVPPRPVGFGPSRSGKGLMPSQNSCKGSSSS 60

Query: 61  GGLLRGLSFKKKGIVSDGERSSLLSSDSQTSPGSPIIARITSAFSWQRCTSLPVTPASNL 120
           GG LRGLSFKKKG V DGERS LL+SD +TSP SPI+A + SAFSWQRCTSLPVTPASNL
Sbjct: 61  GGFLRGLSFKKKGAVPDGERSFLLNSDPKTSPDSPIVASLRSAFSWQRCTSLPVTPASNL 120

Query: 121 SPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSD 180
           SPS+STP SAR  GE  K +      AVSRSLSVPGRN+VIVRS S  + +++     ++
Sbjct: 121 SPSVSTPVSARLPGESIKTSG-----AVSRSLSVPGRNVVIVRSTSFASHKENNLVTPNE 175

Query: 181 DQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTK 240
           DQI  +P+E +DEEI EEEAVCRICLD+C+EGN LKMECSCKGALRLVHEECAI+WFS K
Sbjct: 176 DQI-SSPVEVDDEEIPEEEAVCRICLDVCQEGNMLKMECSCKGALRLVHEECAIKWFSIK 234

Query: 241 GNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSV 284
           GNKNCEVCG+EV+NLPVTLLR++ SAQ +NR++ S Q   S ++
Sbjct: 235 GNKNCEVCGQEVKNLPVTLLRVTGSAQSNNRQDLSHQRFRSEAI 278

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432416|ref|XP_002277762.1| PREDICTED: uncharacterized protein LOC100259554 [Vitis vinifera] gi|297736929|emb|CBI26130.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546476|ref|XP_003541652.1| PREDICTED: uncharacterized protein LOC100777100 [Glycine max] Back     alignment and taxonomy information
>gi|356555575|ref|XP_003546106.1| PREDICTED: uncharacterized protein LOC100527094 [Glycine max] Back     alignment and taxonomy information
>gi|449454458|ref|XP_004144971.1| PREDICTED: uncharacterized protein LOC101219420 [Cucumis sativus] gi|449470479|ref|XP_004152944.1| PREDICTED: uncharacterized protein LOC101219282 [Cucumis sativus] gi|449507660|ref|XP_004163094.1| PREDICTED: uncharacterized protein LOC101227905 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224102537|ref|XP_002312716.1| predicted protein [Populus trichocarpa] gi|222852536|gb|EEE90083.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357447501|ref|XP_003594026.1| E3 ubiquitin-protein ligase MARCH1 [Medicago truncatula] gi|355483074|gb|AES64277.1| E3 ubiquitin-protein ligase MARCH1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255631544|gb|ACU16139.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|21594296|gb|AAM65991.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145331984|ref|NP_001078114.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|222423602|dbj|BAH19770.1| AT3G06330 [Arabidopsis thaliana] gi|332640856|gb|AEE74377.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
TAIR|locus:2144890 411 AT5G18760 "AT5G18760" [Arabido 0.649 0.450 0.505 2.6e-49
TAIR|locus:2081076 426 AT3G06330 [Arabidopsis thalian 0.905 0.605 0.440 1.1e-48
TAIR|locus:2175158 494 AT5G60580 [Arabidopsis thalian 0.543 0.313 0.407 6.6e-26
TAIR|locus:2075064 491 AT3G09760 [Arabidopsis thalian 0.529 0.307 0.377 6.5e-21
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.291 0.406 0.370 7.1e-09
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.252 0.347 0.351 2.7e-07
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.185 0.257 0.465 3.7e-07
TAIR|locus:2012477 265 AT1G14260 [Arabidopsis thalian 0.178 0.192 0.442 5.1e-07
ZFIN|ZDB-GENE-070912-276 339 si:ch211-283p23.1 "si:ch211-28 0.192 0.162 0.392 9.7e-07
ZFIN|ZDB-GENE-060825-323 421 zgc:153256 "zgc:153256" [Danio 0.491 0.332 0.265 3.4e-06
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 467 (169.5 bits), Expect = 2.6e-49, Sum P(2) = 2.6e-49
 Identities = 96/190 (50%), Positives = 125/190 (65%)

Query:    96 IIARITSAFSWQRCTSLPVTPASNLSPSIST-PASARTSGEQHKANKGTAPTAVSRSLSV 154
             + + ITS + W+RC SLP + ++ LS  +ST P SA    EQ K+NK     +VSRSLS+
Sbjct:   100 VASPITSPY-WKRCLSLPSSNSAKLSLVVSTTPVSAVVHSEQPKSNKDGLHASVSRSLSM 158

Query:   155 PGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMXXXXXXXXXXXXVCRICLDICEEGNT 214
                N VIVR+VS    ++H+  + + DQI P P             VCRICLD+CEEGNT
Sbjct:   159 ---NRVIVRAVSFDDNKNHISNEANGDQITPVPAEETEEEIPEEEAVCRICLDVCEEGNT 215

Query:   215 LKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNH 274
             LKMECSCKG LRLVHE CAI+WFSTKG + C+VC +EV+NLPV LLR+ +  Q  NRR  
Sbjct:   216 LKMECSCKGDLRLVHEHCAIKWFSTKGTRICDVCRQEVRNLPVILLRVPTINQLTNRREL 275

Query:   275 SQQTMHSRSV 284
             +QQ+   +S+
Sbjct:   276 TQQSSEPQSI 285
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012477 AT1G14260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-276 si:ch211-283p23.1 "si:ch211-283p23.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060825-323 zgc:153256 "zgc:153256" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VIII.145.1
hypothetical protein (315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 2e-19
pfam1290647 pfam12906, RINGv, RING-variant domain 6e-18
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 1e-10
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 2e-07
PHA02862156 PHA02862, PHA02862, 5L protein; Provisional 1e-05
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 79.3 bits (196), Expect = 2e-19
 Identities = 25/49 (51%), Positives = 33/49 (67%)

Query: 201 VCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCG 249
           +CRIC D  +EG+ L   C CKG+L+ VH+EC  RW +  GNK CE+C 
Sbjct: 1   ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165197 PHA02862, PHA02862, 5L protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.69
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.63
PHA02825162 LAP/PHD finger-like protein; Provisional 99.59
PHA02862156 5L protein; Provisional 99.57
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.49
KOG1609 323 consensus Protein involved in mRNA turnover and st 99.42
KOG3053 293 consensus Uncharacterized conserved protein [Funct 99.33
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.56
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.36
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.87
PHA02929238 N1R/p28-like protein; Provisional 97.87
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.78
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.64
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.63
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.57
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.54
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.52
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.3
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.23
COG52191525 Uncharacterized conserved protein, contains RING Z 97.07
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.02
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.96
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.92
PHA02926242 zinc finger-like protein; Provisional 96.86
KOG149384 consensus Anaphase-promoting complex (APC), subuni 96.75
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.56
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.34
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.3
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.28
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.07
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 95.8
PF1463444 zf-RING_5: zinc-RING finger domain 95.78
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.65
KOG4445 368 consensus Uncharacterized conserved protein, conta 95.04
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 94.93
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 94.69
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.45
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.24
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 93.4
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 91.45
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 91.43
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 90.56
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 90.53
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 90.5
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 90.41
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.15
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 89.67
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 89.64
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 89.02
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 87.87
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 87.87
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 87.24
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 86.82
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 85.16
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 85.12
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 84.6
COG5175 480 MOT2 Transcriptional repressor [Transcription] 83.95
PLN02189 1040 cellulose synthase 83.89
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 83.25
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 83.08
COG5236 493 Uncharacterized conserved protein, contains RING Z 82.94
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 80.51
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 80.48
PLN02436 1094 cellulose synthase A 80.14
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
Probab=99.69  E-value=1.2e-17  Score=119.33  Aligned_cols=49  Identities=51%  Similarity=1.187  Sum_probs=45.6

Q ss_pred             eeeEeccCCCCCCeeecccccCCCcceecHHHHHHHHHhcCCCcccCCC
Q 023250          201 VCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCG  249 (285)
Q Consensus       201 ~CRICle~~e~g~~Li~PC~CkGSl~~VH~~CL~kWl~~kg~~~CEICK  249 (285)
                      +||||++.++++++|++||.|+|+++|||+.||.+|+..+++.+||||+
T Consensus         1 ~CrIC~~~~~~~~~l~~PC~C~G~~~~vH~~Cl~~W~~~~~~~~C~iC~   49 (49)
T smart00744        1 ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK   49 (49)
T ss_pred             CccCCCCCCCCCCeeEeccccCCchhHHHHHHHHHHHHHcCCCcCCCCC
Confidence            5999999666778899999999999999999999999999889999996

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 3e-20
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 3e-19
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-05
3nw0_A238 Non-structural maintenance of chromosomes element 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 81.3 bits (201), Expect = 3e-20
 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKE 251
           E+  VC IC    E GN     C C G L  VH  C   W +   N  C++CG  
Sbjct: 4   EDVPVCWICN--EELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVV 56
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.75
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.73
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.69
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.68
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.65
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.57
2ect_A78 Ring finger protein 126; metal binding protein, st 98.54
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.5
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.46
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.46
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.44
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.44
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.32
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.31
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.28
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.28
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.24
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.24
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.19
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.16
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.12
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.02
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.98
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.98
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.97
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.88
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.87
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.85
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.81
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.72
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.69
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.66
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.64
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.62
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.58
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.57
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.57
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.49
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.45
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.38
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.38
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.29
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.29
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.19
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.09
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.01
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.91
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.81
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.74
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.72
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.68
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.67
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.53
3nw0_A238 Non-structural maintenance of chromosomes element 96.43
2ea5_A68 Cell growth regulator with ring finger domain prot 96.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.28
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.14
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.13
2f42_A179 STIP1 homology and U-box containing protein 1; cha 95.9
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.67
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 95.23
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 94.8
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.24
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 93.42
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 93.34
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 85.33
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 85.03
1weu_A91 Inhibitor of growth family, member 4; structural g 84.1
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 83.16
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 83.15
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.75  E-value=3.3e-19  Score=130.26  Aligned_cols=56  Identities=34%  Similarity=0.789  Sum_probs=50.4

Q ss_pred             CCCCeeeEeccCCCCCCeeecccccCCCcceecHHHHHHHHHhcCCCcccCCCcceec
Q 023250          197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQN  254 (285)
Q Consensus       197 ee~~~CRICle~~e~g~~Li~PC~CkGSl~~VH~~CL~kWl~~kg~~~CEICK~ey~~  254 (285)
                      +++.+||||+++.  +++|++||+|+|+++|||+.||.+|+..+++.+||+|+++|.+
T Consensus         4 ~~~~~CrIC~~~~--~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            4 EDVPVCWICNEEL--GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEEC--SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCEeEEeecCC--CCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            5678999999864  3468999999999999999999999999889999999999974
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 285
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-10
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 4e-05
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 52.9 bits (126), Expect = 3e-10
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQ 253
           E+  VC IC +  E GN     C C G L  VH  C   W +   N  C++CG    
Sbjct: 4   EDVPVCWICNE--ELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN 58
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.55
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.66
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.54
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.51
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.44
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.4
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.31
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.28
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.67
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.66
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.52
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.46
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.7
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.62
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.52
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.28
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 95.98
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 89.64
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 88.27
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 86.34
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.27
d1wema_76 Death associated transcription factor 1, Datf1 (DI 84.03
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 83.29
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 80.99
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 80.63
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.55  E-value=8.1e-16  Score=109.33  Aligned_cols=56  Identities=32%  Similarity=0.745  Sum_probs=50.2

Q ss_pred             CCCCeeeEeccCCCCCCeeecccccCCCcceecHHHHHHHHHhcCCCcccCCCcceec
Q 023250          197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQN  254 (285)
Q Consensus       197 ee~~~CRICle~~e~g~~Li~PC~CkGSl~~VH~~CL~kWl~~kg~~~CEICK~ey~~  254 (285)
                      ++..+|+||+++.+  +.++.||.|.|..++||..||.+|+..+++.+||+|+++|+.
T Consensus         4 ed~~~C~IC~~~~~--~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           4 EDVPVCWICNEELG--NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEECS--CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCccCCccCC--CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            57789999998754  457899999999999999999999999888999999999973
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure