Citrus Sinensis ID: 023284


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MESDEGDEQQQEAERLPLSQRPEWSDVTPIPQDDGPNPVVPIAYKPEFSETMSYFRAVYYSDERSSRSFQLTKEAICLNPGNYTVWHFRRQIIETLHTDLQDELAFVGRIAKSNSKNYQLWHHRRWVAEKLGTGAVNKELQFTKKMLSLDAKNYHAWSYRQWVLQALGGWEDELDYCQMLLGEDIFNNSAWNQRYFVVTRSPLLGGLIAMRDSEVNFTIEAILGNPENESPWRYLRGLYKDDTESWINDPRMLLSVFESFEYQKQLCFCSEHTFRSYLPWFSAK
ccccccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHcHHHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccc
****************PLSQRPEWSDVTPIPQDDGPNPVVPIAYKPEFSETMSYFRAVYYSDERSSRSFQLTKEAICLNPGNYTVWHFRRQIIETLHTDLQDELAFVGRIAKSNSKNYQLWHHRRWVAEKLGTGAVNKELQFTKKMLSLDAKNYHAWSYRQWVLQALGGWEDELDYCQMLLGEDIFNNSAWNQRYFVVTRSPLLGGLIAMRDSEVNFTIEAILGNPENESPWRYLRGLYKDDTESWINDPRMLLSVFESFEYQKQLCFCSEHTFRSYLPWFSA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESDEGDEQQQEAERLPLSQRPEWSDVTPIPQDDGPNPVVPIAYKPEFSETMSYFRAVYYSDERSSRSFQLTKEAICLNPGNYTVWHFRRQIIETLHTDLQDELAFVGRIAKSNSKNYQLWHHRRWVAEKLGTGAVNKELQFTKKMLSLDAKNYHAWSYRQWVLQALGGWEDELDYCQMLLGEDIFNNSAWNQRYFVVTRSPLLGGLIAMRDSEVNFTIEAILGNPENESPWRYLRGLYKDDTESWINDPRMLLSVFESFEYQKQLCFCSEHTFRSYLPWFSAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate.probableQ9LX33
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate.probableP93227

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.59Protein geranylgeranyltransferase type I.probable
2.5.1.58Protein farnesyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DCE, chain A
Confidence level:very confident
Coverage over the Query: 44-244
View the alignment between query and template
View the model in PyMOL
Template: 2H6F, chain A
Confidence level:very confident
Coverage over the Query: 11-259
View the alignment between query and template
View the model in PyMOL
Template: 2OOE, chain A
Confidence level:confident
Coverage over the Query: 42-279
View the alignment between query and template
View the model in PyMOL