Citrus Sinensis ID: 023340


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
MATNSLQSLHHHSFLRRHHPDAAPAAALKPTNPNSLSFSLSNNNNTTTTTTTSANTMITFSSLSPSTTSSSSSSSQTSTTTTTTTTTTSEPISFDLLHQHLQAQNFRQADEETRRLLIALAGEASEKRGYVFFSEVQFIAEADLKAIDELWRQYSDNKFGYSVQKKIWEKVNKDFTNFFIRVGWMKKLDTEMEQYNYRAFPTEFIWENGKETPVGHLPLTNALRGTQLLASILNHPAFEGMQDDDDDDNKQEEEVSKFGGGGDNGVLKTKPLSKSVLKTDYSF
cccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHcccccccccccccccccccccccccccc
*****************************************************************************************EPISFDLLHQHLQAQNFRQADEETRRLLIALAGEASEKRGYVFFSEVQFIAEADLKAIDELWRQYSDNKFGYSVQKKIWEKVNKDFTNFFIRVGWMKKLDTEMEQYNYRAFPTEFIWENGKETPVGHLPLTNALRGTQLLASILNHPAFE*************************************LKTDY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATNSLQSLHHHSFLRRHHPDAAPAAALKPTNPNSLSFSLSNNNNTTTTTTTSANTMITFSSLSPSTTSSSSSSSQTSTTTTTTTTTTSEPISFDLLHQHLQAQNFRQADEETRRLLIALAGEASEKRGYVFFSEVQFIAEADLKAIDELWRQYSDNKFGYSVQKKIWEKVNKDFTNFFIRVGWMKKLDTEMEQYNYRAFPTEFIWENGKETPVGHLPLTNALRGTQLLASILNHPAFEGMQDDDDDDNKQEEEVSKFGGGGDNGVLKTKPLSKSVLKTDYSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tetrapyrrole-binding protein, chloroplastic Regulates chlorophyll synthesis and plastid-to-nucleus signal transduction by binding both the product and the substrate of Mg-chelatase, an enzyme that produces magnesium-protoporphyrin IX (Mg-Proto). Activates also Mg-chelatase.probableQ9LX31

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y6I, chain A
Confidence level:very confident
Coverage over the Query: 87-241
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 18-31
View the alignment between query and template
View the model in PyMOL