Citrus Sinensis ID: 023412

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MDSLCCFNASYSKLVGGRSSSTGKGRSNVGLVKFGFSLVKGKANHPMEDYHVAKFVQLQGHELGLFAIYDGHLGETVPAYLQKHLFSNILKEEEFWVDPQRSISKAYEKTDQAILSHSSDLGRGGSTAVTAILINGQRLWVANVGDSRAVLSTAGVAVQMTTDHEPNTERGSIEDKGGFVSNMPGDVPRVNGQLAVSRAFGDKSLKSHLRSDPDIQNTILDGRSDVLVLASDGLWKVMSNQEAVDIARKFKDPQKAAKQLTAEALKRDSKDDISCVVVRFRG
cccccccccccccccccccccccccccccccEEEEEEECccccccccccEEEEEEcccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccEEEEEEcccccEEEEEccEEEccccccccccHHHHHHHcccEEEEccccccccccHHHHHHHcccccccccccccccEEEEEccccccEEEEEcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccEEEEEEEcc
**SLCCF***Y*****************VGLVKFGFSLVKGKANHPMEDYHVAKFVQLQGHELGLFAIYDGHLGETVPAYLQKHLFSNILKEEEFWVDPQRSISKAYEKTDQAILSHSS**GRGGSTAVTAILINGQRLWVANVGDSRAVLSTAGVAVQMTTDHEPNTERGSIEDKGGFVSNMPGDVPRVNGQLAVSRAFGDKSLKSHLRSDPDIQNTILDGRSDVLVLASDGLWKVMSNQEAVDIARKFKDPQKAAKQLTAEALKRDSKDDISCVVVRFRG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLCCFNASYSKLVGGRSSSTGKGRSNVGLVKFGFSLVKGKANHPMEDYHVAKFVQLQGHELGLFAIYDGHLGETVPAYLQKHLFSNILKEEEFWVDPQRSISKAYEKTDQAILSHSSDLGRGGSTAVTAILINGQRLWVANVGDSRAVLSTAGVAVQMTTDHEPNTERGSIEDKGGFVSNMPGDVPRVNGQLAVSRAFGDKSLKSHLRSDPDIQNTILDGRSDVLVLASDGLWKVMSNQEAVDIARKFKDPQKAAKQLTAEALKRDSKDDISCVVVRFRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein phosphatase 2C 10 confidentQ9S9Z7
Probable protein phosphatase 2C 41 confidentQ7XQU7
Probable protein phosphatase 2C 62 probableQ0D673

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J4O, chain A
Confidence level:very confident
Coverage over the Query: 21-281
View the alignment between query and template
View the model in PyMOL