Citrus Sinensis ID: 023444

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--

MKDPSGAFRMHDAGEIDVRACYTAISVASILNILDDELLQNVGNYILSCQTYEGGIAGEPGSEAHGGYTFCGLAAMILINEADRLDLDALIGWVVFRQGVEGGFQGRTNKLVDGCYSFWQGGVFALLRRFHSIIGESPTPVDQRGAECSIDNTQTTTASDVSEGDGSSDEISSQGDEHCHFQHREREPLFHSIALQRYLLLCSQDPRGGLRDKLRKPRDYYHTCYCLSGLSICQHSWLKDEDSSPLPRAVLGPYSNVLEPVHPVFNIVLDRYHEAHEFFSRS

cccccccEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccc

****SGAFRMHDAGEIDVRACYTAISVASILNILDDELLQNVGNYILSCQTYEGGIAGEPGSEAHGGYTFCGLAAMILINEADRLDLDALIGWVVFRQGVEGGFQGRTNKLVDGCYSFWQGGVFALLRRFHSIIGESPTPVDQRGAECSIDNTQTTTASDVSEGDGSSDEISSQGDEHCHFQHREREPLFHSIALQRYLLLCSQDPRGGLRDKLRKPRDYYHTCYCLSGLSICQHSWLKDEDSSPLPRAVLGPYSNVLEPVHPVFNIVLDRYHEAHEFFSR*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.5.-.-	Transferring alkyl or aryl groups, other than methyl groups.	probable
2.5.1.-	5,10-methenyltetrahydromethanopterin hydrogenase.	probable
2.5.1.58	Protein farnesyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H6F, chain B
Confidence level:very confident
Coverage over the Query: 1-139,184-281
View the alignment between query and template
View the model in PyMOL

Template: 3Q7A, chain B
Confidence level:very confident
Coverage over the Query: 14-236
View the alignment between query and template
View the model in PyMOL