Citrus Sinensis ID: 023467

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--

MVDYEWGNPSTILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTLYHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHSMLSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEAGSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQQPTTTPLQDNQKSQLEPEILASKP

ccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHccccccccccccEEEEccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc

MVDYE**NP**********************HYTTQEPFSQHSTNNNNYFHQPITNTTLY***********************************F******************LSIDAASGGYFMIPKTE********FASRIGLNLGGRTYFSSA************************CQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDN**R******************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Squamosa promoter-binding-like protein 8	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower.	probable	Q8GXL3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UL4, chain A
Confidence level:very confident
Coverage over the Query: 179-259
View the alignment between query and template
View the model in PyMOL