Citrus Sinensis ID: 023501


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MVLEAGLAGVAKQAEQLRLDGNYYFSKDRYGAAIDAYTEAITLCPNVPIYWTNRALCHLKRNDWTKVEADCRKAIQLDHDSVKGHYLLGQTLLQRNEYADGIKELEKALNLGRGAKPKGYIVEDIWQELARAKYLLWEQESSKRSWELQSLKEACEAALEEKHVLDISRKEGFLDEASSTHLKQMEALRQVFRKAAEDDTPAEVPDYLCCKITLDIFRDPVITPSGVTYERAVILDHLDKVGKFDPITREPLRESQLVPNLAIKEAVRAYMDKHGWAYKAS
cccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHcHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccccc
*************AEQLRLDGNYYFSKDRYGAAIDAYTEAITLCPNVPIYWTNRALCHLKRNDWTKVEADCRKAIQLDHDSVKGHYLLGQTLLQRNEYADGIKELEKALNLGRGAKPKGYIVEDIWQELARAKYLLWEQ******WELQ*LKEACEAALEEKHVLDI*****************MEAL*************AEVPDYLCCKITLDIFRDPVITPSGVTYERAVILDHLDKVGKFDPITREPLRESQLVPNLAIKEAVRAYMDKHGWAYK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLEAGLAGVAKQAEQLRLDGNYYFSKDRYGAAIDAYTEAITLCPNVPIYWTNRALCHLKRNDWTKVEADCRKAIQLDHDSVKGHYLLGQTLLQRNEYADGIKELEKALNLGRGAKPKGYIVEDIWQELARAKYLLWEQESSKRSWELQSLKEACEAALEEKHVLDISRKEGFLDEASSTHLKQMEALRQVFRKAAEDDTPAEVPDYLCCKITLDIFRDPVITPSGVTYERAVILDHLDKVGKFDPITREPLRESQLVPNLAIKEAVRAYMDKHGWAYKAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase CHIP Has E3 ubiquitin-protein ligase activity and may target misfolded substrates towards proteasomal degradation. Regulates the activity of some serine/threonine-protein phosphatases by E3 ubiquitin-protein ligase activity. Required for responses to biotic and abiotic stresses such as auxin, abscisic acid (ABA), low and high temperature and darkness, probably through the activation of serine/threonine-protein phosphatase and the subsequent modification of the plasma membrane composition. Regulates the chloroplastic Clp proteolytic activity in response to stresses. Ubiquitylates FtsH1, a component of the chloroplast FtsH protease, and affects protein degradation in chloroplasts. Mediates plastid precursor degradation to prevent cytosolic precursor accumulation, together with the molecular chaperone HSC70-4. Mediates ubiquitination of transit peptides and thereby led to their degradation through the ubiquitin-proteasome system.probableQ9SRS9
STIP1 homology and U box-containing protein 1 E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. Ubiquitinates NOS1 in concert with Hsp70 and Hsp40. Mediates polyubiquitination of DNA polymerase beta (POLB), thereby playing a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. Mediates polyubiquitination of CYP3A4. May ubiquitinate EPHA2 and regulate the receptor stability and activity through proteasomal degradation.probableQ5ZHY5
E3 ubiquitin-protein ligase CHIP E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. Collaborates with ATXN3 in the degradation of misfolded chaperone substrates: ATXN3 restricting the length of ubiquitin chain attached to STUB1/CHIP substrates and preventing further chain extension. Ubiquitinates NOS1 in concert with Hsp70 and Hsp40. Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. Mediates polyubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. Mediates polyubiquitination of CYP3A4. Ubiquitinates EPHA2 and may regulate the receptor stability and activity through proteasomal degradation.probableQ9UNE7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 4-117,134-164
View the alignment between query and template
View the model in PyMOL
Template: 3HYM, chain B
Confidence level:very confident
Coverage over the Query: 10-118,136-195
View the alignment between query and template
View the model in PyMOL
Template: 2C2L, chain A
Confidence level:very confident
Coverage over the Query: 12-280
View the alignment between query and template
View the model in PyMOL