Citrus Sinensis ID: 023511

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFLHLSKH
ccccccEEEEEEEcccccccHHHHHHHHccccccEEEcccccEEEcccccccHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEccccccEEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccHHHHHHHHHHHHHHHHccccccccccccc
ccccccEEEEEEEcccccccHHHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccHHHcEEEEEccHHHHcccHHHHHHHHHHHcccccccEcEEccccccccHHHHHHHHHHHHHcccccccEEEEEEccHEEEccccccccccHHHHHHHEcccccEEEcccccEcEHHccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHccEEEEcccHHHHHHHHHHHHHHHHHHcccccccHHHHHcc
maknvgilamdiyfpptcvQQEAleahdgaskgkytIGLGQECMAFCSEVEDVISMSLTAVTNLLEkykidpkqigrlevgsetvidKSKSIKTFLMQIFEKFgntdiegvdstnacyggtAALFNCVNwvessswdgryglvvctdsavyaegparptgGAAAVVMLVgpdapvafesklrgshmshaydfykpnlaseypvvdgklsqTCYLMALDTCYKCLCSKYeklegkqfslsnadyfvfhspynKLVQKSFARLLFNDFmrnarlpsflhlskh
MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEkykidpkqigrlevgsetvidksKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNArlpsflhlskh
MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFLHLSKH
****VGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGP******************YDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFL*****
**KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARL*********
MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFLHLSKH
***NVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFLHLSKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
P54873 461 Hydroxymethylglutaryl-CoA yes no 0.960 0.585 0.870 1e-146
P54872 482 Hydroxymethylglutaryl-CoA yes no 0.950 0.553 0.614 1e-101
Q5R7Z9 520 Hydroxymethylglutaryl-CoA yes no 0.950 0.513 0.617 4e-98
Q01581 520 Hydroxymethylglutaryl-CoA yes no 0.950 0.513 0.617 6e-98
P23228 522 Hydroxymethylglutaryl-CoA yes no 0.950 0.511 0.625 1e-96
Q8JZK9 520 Hydroxymethylglutaryl-CoA yes no 0.946 0.511 0.608 8e-96
P17425 520 Hydroxymethylglutaryl-CoA yes no 0.946 0.511 0.608 1e-95
Q86HL5 468 Hydroxymethylglutaryl-CoA no no 0.985 0.591 0.568 3e-95
P54961 453 Hydroxymethylglutaryl-CoA N/A no 0.935 0.580 0.611 7e-95
P13704 520 Hydroxymethylglutaryl-CoA yes no 0.946 0.511 0.597 3e-94
>sp|P54873|HMCS_ARATH Hydroxymethylglutaryl-CoA synthase OS=Arabidopsis thaliana GN=HMGS PE=1 SV=2 Back     alignment and function desciption
 Score =  516 bits (1328), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/270 (87%), Positives = 258/270 (95%)

Query: 1   MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTA 60
           MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQ+C+AFC+E+EDVISMS  A
Sbjct: 1   MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNA 60

Query: 61  VTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGG 120
           VT+L EKYKIDP QIGRLEVGSETVIDKSKSIKTFLMQ+FEK GNTD+EGVDSTNACYGG
Sbjct: 61  VTSLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGG 120

Query: 121 TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESK 180
           TAAL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAA+ ML+GPDAP+ FESK
Sbjct: 121 TAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESK 180

Query: 181 LRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSN 240
           LR SHM+H YDFYKPNLASEYPVVDGKLSQTCYLMALD+CYK LC+K+EK+EGK+FS+++
Sbjct: 181 LRASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSIND 240

Query: 241 ADYFVFHSPYNKLVQKSFARLLFNDFMRNA 270
           ADY VFHSPYNKLVQKSFARLL+NDF+RNA
Sbjct: 241 ADYIVFHSPYNKLVQKSFARLLYNDFLRNA 270
This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase. Devoided of acetoacetyl-CoA thiolase (AACT) activity. Required for the development of both tapetosomes and elaioplasts in tapetal cells and for pollen viability during pollen tube elongation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 3EC: .EC: 1EC: 0
>sp|P54872|HMCSA_DICDI Hydroxymethylglutaryl-CoA synthase A OS=Dictyostelium discoideum GN=hgsA PE=1 SV=2 Back     alignment and function description
>sp|Q5R7Z9|HMCS1_PONAB Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Pongo abelii GN=HMGCS1 PE=2 SV=1 Back     alignment and function description
>sp|Q01581|HMCS1_HUMAN Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens GN=HMGCS1 PE=1 SV=2 Back     alignment and function description
>sp|P23228|HMCS1_CHICK Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Gallus gallus GN=HMGCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q8JZK9|HMCS1_MOUSE Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Mus musculus GN=Hmgcs1 PE=1 SV=1 Back     alignment and function description
>sp|P17425|HMCS1_RAT Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Rattus norvegicus GN=Hmgcs1 PE=1 SV=1 Back     alignment and function description
>sp|Q86HL5|HMCSB_DICDI Hydroxymethylglutaryl-CoA synthase B OS=Dictyostelium discoideum GN=hgsB PE=3 SV=1 Back     alignment and function description
>sp|P54961|HMCS1_BLAGE Hydroxymethylglutaryl-CoA synthase 1 OS=Blattella germanica GN=HMGCS-1 PE=2 SV=1 Back     alignment and function description
>sp|P13704|HMCS1_CRIGR Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Cricetulus griseus GN=HMGCS1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
14916100 464 hydroxymethylglutaryl coenzyme A synthas 0.964 0.584 0.918 1e-150
164604966 464 hydroxymethylglutaryl-CoA synthase [Heve 0.960 0.581 0.918 1e-149
16417956 464 hydroxymethylglutaryl coenzyme A synthas 0.960 0.581 0.918 1e-149
42795470 464 HMG-CoA synthase 2 [Hevea brasiliensis] 0.960 0.581 0.914 1e-148
225426749 464 PREDICTED: hydroxymethylglutaryl-CoA syn 0.960 0.581 0.922 1e-148
343466153 465 hydroxymethylglutaryl-CoA synthase [Sira 0.960 0.580 0.918 1e-148
449460467 466 PREDICTED: hydroxymethylglutaryl-CoA syn 0.960 0.579 0.926 1e-148
255537251 464 hydroxymethylglutaryl-CoA synthase, puta 0.960 0.581 0.907 1e-148
164604964 465 hydroxymethylglutaryl-CoA synthase [Heve 0.960 0.580 0.914 1e-148
356563228 460 PREDICTED: hydroxymethylglutaryl-CoA syn 0.960 0.586 0.896 1e-147
>gi|14916100|gb|AAK73854.1| hydroxymethylglutaryl coenzyme A synthase [Hevea brasiliensis] Back     alignment and taxonomy information
 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 249/271 (91%), Positives = 264/271 (97%)

Query: 1   MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTA 60
           MAKNVGILA+DIYFPPT VQQEALEAHDGASKGKYTIGLGQ+CMAFC+EVEDVISMSLTA
Sbjct: 1   MAKNVGILAVDIYFPPTFVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTA 60

Query: 61  VTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGG 120
           VT+LL+KY IDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGG
Sbjct: 61  VTSLLDKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGG 120

Query: 121 TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESK 180
           TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ +LVGPDAP+AFESK
Sbjct: 121 TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILVGPDAPIAFESK 180

Query: 181 LRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSN 240
            RGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALD+CYK  C+KYEK EGKQFS+S+
Sbjct: 181 FRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKFEGKQFSISD 240

Query: 241 ADYFVFHSPYNKLVQKSFARLLFNDFMRNAR 271
           A+YFVFHSPYNKLVQKSFARL+FNDF+RNAR
Sbjct: 241 AEYFVFHSPYNKLVQKSFARLVFNDFVRNAR 271

Source: Hevea brasiliensis

Species: Hevea brasiliensis

Genus: Hevea

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|164604966|dbj|BAF98279.1| hydroxymethylglutaryl-CoA synthase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|16417956|gb|AAL18930.1|AF429389_1 hydroxymethylglutaryl coenzyme A synthase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|42795470|gb|AAS46245.1| HMG-CoA synthase 2 [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|225426749|ref|XP_002282434.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Vitis vinifera] gi|297742614|emb|CBI34763.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|343466153|gb|AEM42970.1| hydroxymethylglutaryl-CoA synthase [Siraitia grosvenorii] Back     alignment and taxonomy information
>gi|449460467|ref|XP_004147967.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Cucumis sativus] gi|449494252|ref|XP_004159493.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255537251|ref|XP_002509692.1| hydroxymethylglutaryl-CoA synthase, putative [Ricinus communis] gi|223549591|gb|EEF51079.1| hydroxymethylglutaryl-CoA synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|164604964|dbj|BAF98278.1| hydroxymethylglutaryl-CoA synthase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|356563228|ref|XP_003549866.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
TAIR|locus:2137015 461 HMGS "HYDROXYMETHYLGLUTARYL-CO 0.960 0.585 0.870 7.1e-132
DICTYBASE|DDB_G0288461 482 hgsA "hydroxymethylglutaryl-Co 0.950 0.553 0.614 2.7e-91
UNIPROTKB|F1N9T0 522 HMGCS1 "Hydroxymethylglutaryl- 0.943 0.507 0.633 1.7e-89
UNIPROTKB|F1NTT0 525 HMGCS1 "Hydroxymethylglutaryl- 0.943 0.504 0.633 1.7e-89
UNIPROTKB|Q01581 520 HMGCS1 "Hydroxymethylglutaryl- 0.950 0.513 0.617 1.7e-89
UNIPROTKB|E2QX73 520 HMGCS1 "Uncharacterized protei 0.946 0.511 0.615 7.5e-89
ZFIN|ZDB-GENE-040426-1042 519 hmgcs1 "3-hydroxy-3-methylglut 0.943 0.510 0.637 9.6e-89
UNIPROTKB|F6RJG0 565 HMGCS1 "Uncharacterized protei 0.946 0.470 0.615 1.2e-88
UNIPROTKB|P23228 522 HMGCS1 "Hydroxymethylglutaryl- 0.943 0.507 0.629 2.5e-88
UNIPROTKB|F1SMG8 548 HMGCS1 "Uncharacterized protei 0.946 0.485 0.608 8.6e-88
TAIR|locus:2137015 HMGS "HYDROXYMETHYLGLUTARYL-COA SYNTHASE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1293 (460.2 bits), Expect = 7.1e-132, P = 7.1e-132
 Identities = 235/270 (87%), Positives = 258/270 (95%)

Query:     1 MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTA 60
             MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQ+C+AFC+E+EDVISMS  A
Sbjct:     1 MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNA 60

Query:    61 VTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGG 120
             VT+L EKYKIDP QIGRLEVGSETVIDKSKSIKTFLMQ+FEK GNTD+EGVDSTNACYGG
Sbjct:    61 VTSLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGG 120

Query:   121 TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESK 180
             TAAL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAA+ ML+GPDAP+ FESK
Sbjct:   121 TAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESK 180

Query:   181 LRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSN 240
             LR SHM+H YDFYKPNLASEYPVVDGKLSQTCYLMALD+CYK LC+K+EK+EGK+FS+++
Sbjct:   181 LRASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSIND 240

Query:   241 ADYFVFHSPYNKLVQKSFARLLFNDFMRNA 270
             ADY VFHSPYNKLVQKSFARLL+NDF+RNA
Sbjct:   241 ADYIVFHSPYNKLVQKSFARLLYNDFLRNA 270
GO:0003824 "catalytic activity" evidence=IEA
GO:0004421 "hydroxymethylglutaryl-CoA synthase activity" evidence=IEA;IGI;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008299 "isoprenoid biosynthetic process" evidence=IEA
GO:0019287 "isopentenyl diphosphate biosynthetic process, mevalonate pathway" evidence=TAS
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006084 "acetyl-CoA metabolic process" evidence=RCA
GO:0003985 "acetyl-CoA C-acetyltransferase activity" evidence=IGI
DICTYBASE|DDB_G0288461 hgsA "hydroxymethylglutaryl-CoA synthase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9T0 HMGCS1 "Hydroxymethylglutaryl-CoA synthase, cytoplasmic" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTT0 HMGCS1 "Hydroxymethylglutaryl-CoA synthase, cytoplasmic" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q01581 HMGCS1 "Hydroxymethylglutaryl-CoA synthase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX73 HMGCS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1042 hmgcs1 "3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6RJG0 HMGCS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P23228 HMGCS1 "Hydroxymethylglutaryl-CoA synthase, cytoplasmic" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMG8 HMGCS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54873HMCS_ARATH2, ., 3, ., 3, ., 1, 00.87030.96080.5856yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.30.963
3rd Layer2.3.3.100.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00001077001
SubName- Full=Chromosome chr2 scaffold_112, whole genome shotgun sequence; (464 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00001656001
SubName- Full=Chromosome undetermined scaffold_119, whole genome shotgun sequence; (242 aa)
• ••  • 0.883
GSVIVG00029076001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (381 aa)
•  • •• 0.567
GSVIVG00022848001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (388 aa)
  ••  • 0.543
GSVIVG00006002001
SubName- Full=Chromosome chr4 scaffold_162, whole genome shotgun sequence; (552 aa)
•    •• 0.499
GSVIVG00033429001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (341 aa)
   •  • 0.481
GSVIVG00002942001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (550 aa)
•    •• 0.473
GSVIVG00036301001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (575 aa)
•    •• 0.458
GSVIVG00035946001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (413 aa)
   •  • 0.411

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
PLN02577 459 PLN02577, PLN02577, hydroxymethylglutaryl-CoA synt 0.0
TIGR01833 457 TIGR01833, HMG-CoA-S_euk, 3-hydroxy-3-methylglutar 0.0
pfam01154171 pfam01154, HMG_CoA_synt_N, Hydroxymethylglutaryl-c 3e-94
COG3425 377 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synt 2e-81
cd00827324 cd00827, init_cond_enzymes, "initiating" condensin 3e-69
pfam08540 282 pfam08540, HMG_CoA_synt_C, Hydroxymethylglutaryl-c 2e-54
TIGR01835 379 TIGR01835, HMG-CoA-S_prok, 3-hydroxy-3-methylgluta 3e-37
TIGR00748345 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl- 7e-15
PRK04262347 PRK04262, PRK04262, hypothetical protein; Provisio 2e-13
COG0332323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 7e-06
>gnl|CDD|178189 PLN02577, PLN02577, hydroxymethylglutaryl-CoA synthase Back     alignment and domain information 
 Score =  595 bits (1537), Expect = 0.0
 Identities = 234/270 (86%), Positives = 252/270 (93%)

Query: 1   MAKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTA 60
           M KNVGILAM++YFPPTCVQQEALEAHDG SKGKYTIGLGQ+CMAFC++VEDVISMSLT 
Sbjct: 1   MPKNVGILAMEVYFPPTCVQQEALEAHDGVSKGKYTIGLGQDCMAFCTDVEDVISMSLTV 60

Query: 61  VTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGG 120
           V +LLEKY IDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FE+ GNTDIEGVDSTNACYGG
Sbjct: 61  VKSLLEKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEESGNTDIEGVDSTNACYGG 120

Query: 121 TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESK 180
           TAAL NCVNWVESSSWDGRYGLVV  DSAVYAEGPARPTGGA AV MLVGP+AP+ FESK
Sbjct: 121 TAALLNCVNWVESSSWDGRYGLVVAADSAVYAEGPARPTGGAGAVAMLVGPNAPIVFESK 180

Query: 181 LRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSN 240
            RGSHM+H YDFYKP+LASEYPVVDGKLSQTCYLMALD+CYK  C KYEKLEGKQFS+S+
Sbjct: 181 YRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKRFCEKYEKLEGKQFSISD 240

Query: 241 ADYFVFHSPYNKLVQKSFARLLFNDFMRNA 270
           ADYFVFH+PYNKLVQKSFARL++NDF RNA
Sbjct: 241 ADYFVFHAPYNKLVQKSFARLVYNDFQRNA 270

Length = 459
>gnl|CDD|233591 TIGR01833, HMG-CoA-S_euk, 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>gnl|CDD|110176 pfam01154, HMG_CoA_synt_N, Hydroxymethylglutaryl-coenzyme A synthase N terminal Back     alignment and domain information
>gnl|CDD|225959 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|238423 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>gnl|CDD|219892 pfam08540, HMG_CoA_synt_C, Hydroxymethylglutaryl-coenzyme A synthase C terminal Back     alignment and domain information
>gnl|CDD|213655 TIGR01835, HMG-CoA-S_prok, 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>gnl|CDD|129831 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>gnl|CDD|235266 PRK04262, PRK04262, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 100.0
PLN02577 459 hydroxymethylglutaryl-CoA synthase 100.0
TIGR01833 454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 100.0
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
COG3425 377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 100.0
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PRK04262347 hypothetical protein; Provisional 100.0
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 100.0
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 100.0
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 100.0
TIGR01835 379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 100.0
PRK06840339 hypothetical protein; Validated 100.0
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 100.0
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 100.0
PLN03169391 chalcone synthase family protein; Provisional 100.0
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 100.0
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PLN03171399 chalcone synthase-like protein; Provisional 100.0
PLN03172393 chalcone synthase family protein; Provisional 100.0
PLN03168389 chalcone synthase; Provisional 100.0
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PLN03173391 chalcone synthase; Provisional 100.0
cd00827324 init_cond_enzymes "initiating" condensing enzymes 100.0
PLN03170401 chalcone synthase; Provisional 100.0
PLN02377502 3-ketoacyl-CoA synthase 100.0
KOG1393 462 consensus Hydroxymethylglutaryl-CoA synthase [Lipi 100.0
PLN02932478 3-ketoacyl-CoA synthase 100.0
PLN02854521 3-ketoacyl-CoA synthase 100.0
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 100.0
PLN02192511 3-ketoacyl-CoA synthase 100.0
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 99.98
PLN00415466 3-ketoacyl-CoA synthase 99.97
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 99.94
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.91
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 99.88
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 99.86
TIGR02845327 spore_V_AD stage V sporulation protein AD. Bacillu 99.83
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.79
PRK08304337 stage V sporulation protein AD; Validated 99.76
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 99.63
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 99.59
cd00829 375 SCP-x_thiolase Thiolase domain associated with ste 99.57
PRK12404334 stage V sporulation protein AD; Provisional 99.54
PRK06064 389 acetyl-CoA acetyltransferase; Provisional 99.53
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of be 99.52
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.49
PRK06158 384 thiolase; Provisional 99.47
cd00751 386 thiolase Thiolase are ubiquitous enzymes that cata 99.47
TIGR01930 386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.44
cd00828407 elong_cond_enzymes "elongating" condensing enzymes 99.42
PRK12578 385 acetyl-CoA acetyltransferase; Provisional 99.42
PRK05656 393 acetyl-CoA acetyltransferase; Provisional 99.41
PRK07108 392 acetyl-CoA acetyltransferase; Provisional 99.38
PRK09051 394 beta-ketothiolase; Provisional 99.38
cd00833421 PKS polyketide synthases (PKSs) polymerize simple 99.38
PRK08313 386 acetyl-CoA acetyltransferase; Provisional 99.37
PRK06205 404 acetyl-CoA acetyltransferase; Provisional 99.37
PRK09052 399 acetyl-CoA acetyltransferase; Provisional 99.37
PRK08235 393 acetyl-CoA acetyltransferase; Provisional 99.37
TIGR03150407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 99.35
PRK08242 402 acetyl-CoA acetyltransferase; Validated 99.34
PRK06059 399 lipid-transfer protein; Provisional 99.33
cd00826 393 nondecarbox_cond_enzymes nondecarboxylating conden 99.32
PRK05790 393 putative acyltransferase; Provisional 99.31
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 99.28
PRK06289 403 acetyl-CoA acetyltransferase; Provisional 99.28
PRK06954 397 acetyl-CoA acetyltransferase; Provisional 99.28
PRK06065 392 acetyl-CoA acetyltransferase; Provisional 99.26
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.24
PRK06445 394 acetyl-CoA acetyltransferase; Provisional 99.22
PRK07516 389 acetyl-CoA acetyltransferase; Provisional 99.22
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 99.22
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 99.21
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.19
PRK09185392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.16
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.16
PRK08439406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.15
PLN02287 452 3-ketoacyl-CoA thiolase 99.15
PLN02836437 3-oxoacyl-[acyl-carrier-protein] synthase 99.14
PRK07661 391 acetyl-CoA acetyltransferase; Provisional 99.14
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.13
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 99.11
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.08
PRK08256 391 lipid-transfer protein; Provisional 99.07
PRK07851 406 acetyl-CoA acetyltransferase; Provisional 99.07
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 99.06
cd00832399 CLF Chain-length factor (CLF) is a factor required 99.05
PRK06157 398 acetyl-CoA acetyltransferase; Validated 99.02
PTZ00455 438 3-ketoacyl-CoA thiolase; Provisional 99.01
PTZ00050421 3-oxoacyl-acyl carrier protein synthase; Provision 99.01
PRK08131 401 acetyl-CoA acetyltransferase; Provisional 98.98
PRK08963 428 fadI 3-ketoacyl-CoA thiolase; Reviewed 98.97
PRK07850 387 acetyl-CoA acetyltransferase; Provisional 98.96
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 98.96
PRK06633 392 acetyl-CoA acetyltransferase; Provisional 98.95
TIGR02446 430 FadI fatty oxidation complex, beta subunit FadI. T 98.95
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 98.94
PRK06366 388 acetyl-CoA acetyltransferase; Provisional 98.94
PLN02644 394 acetyl-CoA C-acetyltransferase 98.92
PRK09050 401 beta-ketoadipyl CoA thiolase; Validated 98.91
PRK13359 400 beta-ketoadipyl CoA thiolase; Provisional 98.9
PRK06504 390 acetyl-CoA acetyltransferase; Provisional 98.88
TIGR02430 400 pcaF beta-ketoadipyl CoA thiolase. Members of this 98.87
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.84
PRK08947 387 fadA 3-ketoacyl-CoA thiolase; Reviewed 98.81
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.8
TIGR02445 385 fadA fatty oxidation complex, beta subunit FadA. T 98.79
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 98.77
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 98.75
PRK07801 382 acetyl-CoA acetyltransferase; Provisional 98.74
PRK08142 388 acetyl-CoA acetyltransferase; Provisional 98.72
PF07451329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 98.7
PF08540 282 HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A s 98.68
PRK08257 498 acetyl-CoA acetyltransferase; Validated 98.61
PRK06066 385 acetyl-CoA acetyltransferase; Provisional 98.6
PRK07855 386 lipid-transfer protein; Provisional 98.56
PRK06025 417 acetyl-CoA acetyltransferase; Provisional 98.55
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 98.53
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 98.52
PRK06690 361 acetyl-CoA acetyltransferase; Provisional 98.41
PRK07937 352 lipid-transfer protein; Provisional 98.4
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.37
COG3321 1061 Polyketide synthase modules and related proteins [ 98.35
KOG1406 408 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44 98.2
KOG1394440 consensus 3-oxoacyl-(acyl-carrier-protein) synthas 98.06
COG0183 392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 97.82
PF02797151 Chal_sti_synt_C: Chalcone and stilbene synthases, 97.72
KOG1390 396 consensus Acetyl-CoA acetyltransferase [Lipid tran 97.46
KOG1391 396 consensus Acetyl-CoA acetyltransferase [Lipid tran 96.9
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 96.05
KOG1392 465 consensus Acetyl-CoA acetyltransferase [Lipid tran 95.71
PRK06025417 acetyl-CoA acetyltransferase; Provisional 95.57
KOG1389 435 consensus 3-oxoacyl CoA thiolase [Lipid transport 95.42
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 94.19
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 94.07
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 94.02
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 93.73
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 93.19
PRK06205404 acetyl-CoA acetyltransferase; Provisional 93.03
PRK09052399 acetyl-CoA acetyltransferase; Provisional 91.89
PRK08257498 acetyl-CoA acetyltransferase; Validated 91.63
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 91.57
PRK08242402 acetyl-CoA acetyltransferase; Validated 91.03
PRK06690361 acetyl-CoA acetyltransferase; Provisional 91.01
PRK06366388 acetyl-CoA acetyltransferase; Provisional 91.0
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 90.99
PRK07661391 acetyl-CoA acetyltransferase; Provisional 90.69
PRK07851406 acetyl-CoA acetyltransferase; Provisional 90.48
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 90.34
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 90.28
PRK05656393 acetyl-CoA acetyltransferase; Provisional 90.1
PRK04262347 hypothetical protein; Provisional 89.97
PRK07850387 acetyl-CoA acetyltransferase; Provisional 89.97
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 89.88
PRK12578385 acetyl-CoA acetyltransferase; Provisional 89.76
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 89.76
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 89.63
PRK07937352 lipid-transfer protein; Provisional 89.35
PRK06840339 hypothetical protein; Validated 88.95
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 88.46
PLN02287452 3-ketoacyl-CoA thiolase 88.43
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 88.19
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 87.99
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 87.52
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 87.38
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 87.28
PRK09268427 acetyl-CoA acetyltransferase; Provisional 87.0
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 86.99
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 86.13
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 84.92
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 84.65
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 84.25
PRK05790393 putative acyltransferase; Provisional 83.7
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 83.52
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 83.42
PRK06158384 thiolase; Provisional 83.32
PRK08142388 acetyl-CoA acetyltransferase; Provisional 83.24
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 82.44
PRK06066385 acetyl-CoA acetyltransferase; Provisional 81.89
PRK08313386 acetyl-CoA acetyltransferase; Provisional 81.31
PRK06065392 acetyl-CoA acetyltransferase; Provisional 81.13
PRK07855386 lipid-transfer protein; Provisional 80.74
PRK08235393 acetyl-CoA acetyltransferase; Provisional 80.71
PRK06289403 acetyl-CoA acetyltransferase; Provisional 80.32
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 80.24
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-54  Score=388.13  Aligned_cols=269  Identities=19%  Similarity=0.186  Sum_probs=235.9

Q ss_pred             ceeEEeEEEEEcCCcccchhHHHhhhCCCCceeeeecCceeeeeCCCCCCHHHHHHHHHHHHHHHcCCCcCCccEEEEec
Q 023511            3 KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNLLEKYKIDPKQIGRLEVGS   82 (281)
Q Consensus         3 ~~v~I~~ig~~lP~~~v~~~~~~~~~~~~~~~~~~gi~~r~~~~~~~~e~~~~la~~Aa~~aL~~a~l~~~dId~li~~s   82 (281)
                      ++++|.|+|.|+|+++++|++++++.+++++||.+-+|.|+|+++.++|+.++|+++|+++||+++|++|+|||+||++|
T Consensus         2 ~~a~i~g~G~~lP~~~vtn~d~e~~~~tsdewI~~rtGir~R~~a~~~e~~s~la~~Aa~~AL~~Agi~~~dIDlII~aT   81 (323)
T COG0332           2 MNAKILGIGSYLPERVVTNADLEKRVDTSDEWIETRTGIRERRIAADDETTSDLAVEAARKALEDAGISPDDIDLIIVAT   81 (323)
T ss_pred             CcceEEEEEeecCCcccChHHHHhccCCCcceeeeecCCceeeecCCCccHHHHHHHHHHHHHHHcCCCHHHCCEEEEEc
Confidence            68999999999999999999999999999999996666666669989999999999999999999999999999999999


Q ss_pred             ccCCCCCcchHHHHHHHHhhcCCCCceeeecccccchHHHHHHHHHHHHHhCCCCCCeEEEEEeeccc----ccCCCCcc
Q 023511           83 ETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAV----YAEGPARP  158 (281)
Q Consensus        83 ~t~~~~~p~~a~~i~~~l~~~g~~~~~~~di~~~C~g~~~aL~~A~~~l~~g~~~~~~aLVV~~e~~s----~~~~~~~~  158 (281)
                      .||++..|++|+.||..||.   .++.+||++.+|+||++||.+|..|+++|.+  +++|||++|.+|    ++++.+..
T Consensus        82 ~tpd~~~Ps~A~~vq~~LG~---~~~~afDl~aaCsgf~yaL~~A~~~i~sG~~--k~vLVVg~e~~S~~ld~~dR~t~v  156 (323)
T COG0332          82 STPDHLFPSTACLVQARLGL---GGAPAFDLQAACSGFLYALSVADGLIRSGGY--KNVLVVGAETLSRILDWTDRDTCV  156 (323)
T ss_pred             CCcccCCChHHHHHHHHhCC---CCcceeechhhhHHHHHHHHHHHHHHHcCCC--CEEEEEehhHhhccCCHhhccceE
Confidence            99999999999999988876   4589999999999999999999999999987  999999999998    45678999


Q ss_pred             ccCcceEEEEEccCC-CccccccccccccCCcccccccCCCCcc-c--CCCCcc---cHHHHHHHHHHHHHHHHHHHHHh
Q 023511          159 TGGAAAVVMLVGPDA-PVAFESKLRGSHMSHAYDFYKPNLASEY-P--VVDGKL---SQTCYLMALDTCYKCLCSKYEKL  231 (281)
Q Consensus       159 ~fGDGAaA~ll~~~~-~~~i~~~~~~s~~~~~~~~~~p~~~~~~-~--~~~~~~---~~~~~~~~~~~~~~~~~~~~~~l  231 (281)
                      +|||||+|+||++.+ ..+|+...+++++.....++.|.+++.. +  ...+.+   ..++|.++++.+.+.+.   +.|
T Consensus       157 lFgDGAgAvvl~~~~~~~~i~~~~l~sdg~~~~~l~~~~~~~~~~~~~~~~~~~~m~Gr~vfk~av~~~~~~~~---~~L  233 (323)
T COG0332         157 LFGDGAGAVVLEATEDDNGILDTDLGSDGSQGDLLYLPGGGSATPKEESGGGLLVMDGREVFKFAVRAMPKAIE---EVL  233 (323)
T ss_pred             EEcCCceEEEEecCCCCcCeeeeeeeccccCCCeeeccCCCCccccccccccceeeccHHHHHHHHHHHHHHHH---HHH
Confidence            999999999999987 5688888788888876555555432221 0  000111   25889999988888887   568


Q ss_pred             hcCCCCCCCCcEEecCCCChhHHHHHHHhccchhhhhcCCCccccccC
Q 023511          232 EGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARLPSFLHLS  279 (281)
Q Consensus       232 ~~~g~~~~did~~i~Hq~n~~i~~~~~~~lg~~~~~~~~~~~~~~~~~  279 (281)
                      +++|++++|||||+|||+|.+|++.+.++||+++++.-..-++|+|-|
T Consensus       234 ~~~~l~~~dId~~vpHQan~ri~~~i~~~l~~~~~k~~~~~~~yGNts  281 (323)
T COG0332         234 EKAGLTPEDIDWFVPHQANLRIIEAIAKKLGIPEEKVVVTVDKYGNTS  281 (323)
T ss_pred             HHcCCCHHHCCEEccccccHHHHHHHHHHcCCCHHHHhhHHHHhcccc
Confidence            999999999999999999999999999999999999999999999975

>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>KOG1393 consensus Hydroxymethylglutaryl-CoA synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PF08540 HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A synthase C terminal; InterPro: IPR013746 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1406 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism] Back     alignment and domain information
>KOG1394 consensus 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PF02797 Chal_sti_synt_C: Chalcone and stilbene synthases, C-terminal domain; InterPro: IPR012328 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1391 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>KOG1392 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1389 consensus 3-oxoacyl CoA thiolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
2f82_A 450 Hmg-Coa Synthase From Brassica Juncea In The Apo-Fo 1e-149
2fa3_A 450 Hmg-Coa Synthase From Brassica Juncea In Complex Wi 1e-148
2p8u_A 478 Crystal Structure Of Human 3-Hydroxy-3-Methylglutar 6e-98
2wya_A 460 Crystal Structure Of Human Mitochondrial 3-Hydroxy- 1e-95
1x9e_A 383 Crystal Structure Of Hmg-Coa Synthase From Enteroco 2e-20
3v4x_A 388 The Biochemical And Structural Basis For Inhibition 2e-20
2hdb_A 383 Hmg-coa Synthase From Enterococcus Faecalis. Mutati 5e-20
1ysl_A 402 Crystal Structure Of Hmg-Coa Synthase From Enteroco 2e-19
3v4n_A 388 The Biochemical And Structural Basis For Inhibition 3e-19
1ysl_B 384 Crystal Structure Of Hmg-Coa Synthase From Enteroco 4e-19
1xpk_C 388 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 4e-17
1tvz_A 388 Crystal Structure Of 3-hydroxy-3-methylglutaryl-coe 5e-16
1xpk_B 388 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 5e-16
1xpk_D 388 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 6e-16
1xpl_B 390 Crystal Structure Of Staphylococcus Aureus Hmg-coa 6e-16
3leh_A 425 The Crystal Structure Of Smu.943c From Streptococcu 1e-12
3sqz_A 389 Crystal Structure Of Hmg_coa Synthase Complexed Wit 2e-11
>pdb|2F82|A Chain A, Hmg-Coa Synthase From Brassica Juncea In The Apo-Form Length = 450 Back     alignment and structure 
Iteration: 1

 Score =  523 bits (1346), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 239/269 (88%), Positives = 261/269 (97%)
Query: 2   AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAV 61
           AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQ+C+AFC+E+EDVISMS  AV
Sbjct: 1   AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAV 60
Query: 62  TNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGT 121
           T+LLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEK GNTD+EGVDSTNACYGGT
Sbjct: 61  TSLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGT 120
Query: 122 AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKL 181
           AAL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAA+ ML+GPDAP+ FESKL
Sbjct: 121 AALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKL 180
Query: 182 RGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNA 241
           RGSHM+H YDFYKPNLASEYPVVDGKLSQTCYLMALD+CYK LC+K+EKLEGK+FS+++A
Sbjct: 181 RGSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDA 240
Query: 242 DYFVFHSPYNKLVQKSFARLLFNDFMRNA 270
           DYFVFHSPYNKLVQKSFARLL+NDF+RNA
Sbjct: 241 DYFVFHSPYNKLVQKSFARLLYNDFLRNA 269
>pdb|2FA3|A Chain A, Hmg-Coa Synthase From Brassica Juncea In Complex With Acetyl-Coa And Acetyl-Cys117 Length = 450 Back     alignment and structure
>pdb|2P8U|A Chain A, Crystal Structure Of Human 3-Hydroxy-3-Methylglutaryl Coa Synthase I Length = 478 Back     alignment and structure
>pdb|2WYA|A Chain A, Crystal Structure Of Human Mitochondrial 3-Hydroxy-3- Methylglutaryl-Coenzyme A Synthase 2 (Hmgcs2) Length = 460 Back     alignment and structure
>pdb|1X9E|A Chain A, Crystal Structure Of Hmg-Coa Synthase From Enterococcus Faecalis Length = 383 Back     alignment and structure
>pdb|3V4X|A Chain A, The Biochemical And Structural Basis For Inhibition Of Enterococcus Faecalis Hmg-Coa Synthase, Mvas, By Hymeglusin Length = 388 Back     alignment and structure
>pdb|2HDB|A Chain A, Hmg-coa Synthase From Enterococcus Faecalis. Mutation Alanine 110 To Glycine Length = 383 Back     alignment and structure
>pdb|1YSL|A Chain A, Crystal Structure Of Hmg-Coa Synthase From Enterococcus Faecalis With Acetoacetyl-Coa Ligand Length = 402 Back     alignment and structure
>pdb|3V4N|A Chain A, The Biochemical And Structural Basis For Inhibition Of Enterococcus Faecalis Hmg-coa Synthatse, Mvas, By Hymeglusin Length = 388 Back     alignment and structure
>pdb|1XPK|C Chain C, Crystal Structure Of Staphylococcus Aureus Hmg-Coa Synthase With Hmg- Coa And With Acetoacetyl-Coa And Acetylated Cysteine Length = 388 Back     alignment and structure
>pdb|1TVZ|A Chain A, Crystal Structure Of 3-hydroxy-3-methylglutaryl-coenzyme A Synthase From Staphylococcus Aureus Length = 388 Back     alignment and structure
>pdb|1XPK|B Chain B, Crystal Structure Of Staphylococcus Aureus Hmg-Coa Synthase With Hmg- Coa And With Acetoacetyl-Coa And Acetylated Cysteine Length = 388 Back     alignment and structure
>pdb|3LEH|A Chain A, The Crystal Structure Of Smu.943c From Streptococcus Mutans Ua159 Length = 425 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 1e-107
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 1e-103
2p8u_A 478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 1e-102
2v4w_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 1e-101
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 3e-90
3v4n_A 388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 3e-89
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Length = 450 Back     alignment and structure
 Score =  318 bits (816), Expect = e-107
 Identities = 239/270 (88%), Positives = 261/270 (96%)

Query: 2   AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAV 61
           AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQ+C+AFC+E+EDVISMS  AV
Sbjct: 1   AKNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAV 60

Query: 62  TNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGT 121
           T+LLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEK GNTD+EGVDSTNACYGGT
Sbjct: 61  TSLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGT 120

Query: 122 AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKL 181
           AAL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAA+ ML+GPDAP+ FESKL
Sbjct: 121 AALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKL 180

Query: 182 RGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNA 241
           RGSHM+H YDFYKPNLASEYPVVDGKLSQTCYLMALD+CYK LC+K+EKLEGK+FS+++A
Sbjct: 181 RGSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDA 240

Query: 242 DYFVFHSPYNKLVQKSFARLLFNDFMRNAR 271
           DYFVFHSPYNKLVQKSFARLL+NDF+RNA 
Sbjct: 241 DYFVFHSPYNKLVQKSFARLLYNDFLRNAS 270
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Length = 396 Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Length = 478 Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
2v4w_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 100.0
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 100.0
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 100.0
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 100.0
2p8u_A 478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 100.0
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 100.0
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 100.0
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 100.0
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 100.0
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 100.0
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 100.0
3v4n_A 388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 100.0
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 100.0
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 100.0
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 100.0
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 100.0
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 100.0
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 100.0
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 100.0
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 100.0
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 100.0
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 100.0
3oit_A387 OS07G0271500 protein; type III polyketide synthase 100.0
3e1h_A 465 PKSIIINC, putative uncharacterized protein; resorc 100.0
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 100.0
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 100.0
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 100.0
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 100.0
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 100.0
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 100.0
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 100.0
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 100.0
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
3awk_A402 Chalcone synthase-like polyketide synthase; type I 100.0
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 100.0
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 100.0
1xes_A413 Dihydropinosylvin synthase; native structure, tran 100.0
3v7i_A413 Putative polyketide synthase; type III polyketide 100.0
1u0m_A382 Putative polyketide synthase; type III polyketide 100.0
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 100.0
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 99.95
2iik_A 418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.81
4e1l_A 395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.81
3ss6_A 394 Acetyl-COA acetyltransferase; structural genomics, 99.81
4dd5_A 396 Acetyl-COA acetyltransferase; structural genomics, 99.8
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 99.78
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 99.75
3goa_A 387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.75
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 99.74
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 99.74
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 99.74
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 99.74
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 99.74
3svk_A 407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.74
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 99.73
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 99.73
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 99.7
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 99.7
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 99.68
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 99.67
1wl4_A 397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.67
1ulq_A 401 Putative acetyl-COA acetyltransferase; structural 99.66
2vu1_A 392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.66
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 99.66
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 99.65
1afw_A 393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.64
2ib8_A 395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.62
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 99.62
1wdk_C 390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.62
2wu9_A 442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.61
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 99.59
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 99.58
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 99.55
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 99.55
4egv_A 520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.17
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.96
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.82
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.74
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.44
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.4
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 95.23
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 92.19
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 92.15
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 91.86
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 91.74
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 91.1
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 91.02
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 90.97
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 90.88
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 90.87
4egv_A520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 90.86
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 90.82
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 90.71
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 90.22
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 89.79
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 89.78
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 89.67
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 89.59
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 89.58
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 89.19
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 88.75
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 88.24
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 88.13
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 87.92
1u0m_A382 Putative polyketide synthase; type III polyketide 87.37
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 87.07
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 87.02
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 84.7
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 83.41
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 82.88
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 81.48
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 81.29
3v4n_A388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 80.52
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 80.31
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1xpma1166 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA 5e-31
d1xpma2 221 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl Co 3e-27
d1u6ea1184 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (Fa 7e-10
d1bi5a1235 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Med 1e-04
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: 3-hydroxy-3-methylglutaryl CoA synthase MvaS
species: Staphylococcus aureus [TaxId: 1280]

 Score =  111 bits (279), Expect = 5e-31
 Identities = 43/169 (25%), Positives = 71/169 (42%), Gaps = 7/169 (4%)

Query: 5   VGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVTNL 64
           +GI  ++ Y P   V    L         K+ IG+GQ  MA     +D++SM   A    
Sbjct: 2   IGIDKINFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMAVSPVNQDIVSMGANAA--K 59

Query: 65  LEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTAAL 124
                 D K+IG + V +E+ +D +K+    +  +            +   ACY  T A+
Sbjct: 60  DIITDEDKKKIGMVIVATESAVDAAKAAAVQIHNLL--GIQPFARCFEMKEACYAATPAI 117

Query: 125 FNCVNWVESSSWDGRYGLVVCTDSAVYA-EGPARPTGGAAAVVMLVGPD 172
               +++   +      LV+ TD+A Y       PT GA AV M++  +
Sbjct: 118 QLAKDYLA--TRPNEKVLVIATDTARYGLNSGGEPTQGAGAVAMVIAHN 164
>d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Length = 221 Back     information, alignment and structure
>d1u6ea1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 235 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 100.0
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 100.0
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 100.0
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 100.0
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 100.0
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 100.0
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 99.97
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 99.97
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 99.4
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 99.34
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 99.3
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 99.22
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 99.2
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.1
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 99.1
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 99.1
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.09
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 98.97
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 98.93
d1ee0a2160 Pyrone synthase (PyS, chalcone synthase 2) {Gerber 98.87
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 98.83
d1u0ua2156 Dihydropinosylvin synthase {Scots pine (Pinus sylv 98.81
d1bi5a2154 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 98.78
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 98.7
d1xpma2 221 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 98.62
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 98.58
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 98.51
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 98.48
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 98.27
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 96.17
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 95.91
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 95.86
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 95.6
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 92.21
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 91.96
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 91.87
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 91.7
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 87.93
d1tqyb2194 Actinorhodin polyketide putative beta-ketoacyl syn 87.0
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 87.0
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 84.74
d1tqya2205 Actinorhodin polyketide putative beta-ketoacyl syn 81.75
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 80.86
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 80.8
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Polyketide synthase PKS18
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=2.2e-42  Score=317.13  Aligned_cols=267  Identities=15%  Similarity=0.127  Sum_probs=191.3

Q ss_pred             eeEEeEEEEEcCCcccchhHHHhhhCC---CC---cee---e--eecCceeeeeCCC---------------------CC
Q 023511            4 NVGILAMDIYFPPTCVQQEALEAHDGA---SK---GKY---T--IGLGQECMAFCSE---------------------VE   51 (281)
Q Consensus         4 ~v~I~~ig~~lP~~~v~~~~~~~~~~~---~~---~~~---~--~gi~~r~~~~~~~---------------------~e   51 (281)
                      ..+|.|+|+|+|+++|+|+|+.++++.   ++   +++   .  +||.+||+...+.                     +|
T Consensus        11 ~a~I~g~g~~~P~~~v~n~e~~~~~~~~~~~~~~~~~~~ri~~~tGI~~R~~~~~~~~~~~~~~~~~~~~~~~r~~~~~e   90 (372)
T d1teda_          11 VAVIEGLATGTPRRVVNQSDAADRVAELFLDPGQRERIPRVYQKSRITTRRMAVDPLDAKFDVFRREPATIRDRMHLFYE   90 (372)
T ss_dssp             EEEEEEEEEECCSCEEEHHHHHHHHHTC----CCTTHHHHHHHTSCCSEEECSSCTTSTTHHHHTTCSSCHHHHHHHHHH
T ss_pred             eEEEEEEEEeCCCeEEcHHHHHHHHHhhcCChHHHHHHHHHHHccCCcccceeccccccchhhhhhcCCCHHHHHHHHHh
Confidence            568999999999999999999987632   12   122   2  5777776422111                     24


Q ss_pred             CHHHHHHHHHHHHHHHcCCCcCCccEEEEecccCCCCCcchHHHHHHHHhhcCCCCceeeeccc-ccchHHHHHHHHHHH
Q 023511           52 DVISMSLTAVTNLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTN-ACYGGTAALFNCVNW  130 (281)
Q Consensus        52 ~~~~la~~Aa~~aL~~a~l~~~dId~li~~s~t~~~~~p~~a~~i~~~l~~~g~~~~~~~di~~-~C~g~~~aL~~A~~~  130 (281)
                      ++.+|+++|+++||+++|++|+|||+||++|+| ++..|+++++|++.||+.  +++.++++++ ||+||++||++|..+
T Consensus        91 ~~~~la~~Aa~~aL~~ag~~~~dId~lI~~t~t-~~~~P~~a~~v~~~LGl~--~~~~~~~~~~~gC~g~~~aL~~A~~~  167 (372)
T d1teda_          91 HAVPLAVDVSKRALAGLPYRAAEIGLLVLATST-GFIAPGVDVAIVKELGLS--PSISRVVVNFMGCAAAMNALGTATNY  167 (372)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCGGGEEEEEEEESS-CCCSSCHHHHHHHHHTCC--TTCEEEEEESCGGGHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCCHHHCCEEEEeccC-CCCCchHHHHHHhhhccC--CceeEeeccccCccHHHHHHHHHHHH
Confidence            688999999999999999999999999999987 577999999999999864  3567788865 999999999999999


Q ss_pred             HHhCCCCCCeEEEEEeeccccc----CC----CCccccCcceEEEEEccCCCc-cccccccccccCCcccccc-cCCCCc
Q 023511          131 VESSSWDGRYGLVVCTDSAVYA----EG----PARPTGGAAAVVMLVGPDAPV-AFESKLRGSHMSHAYDFYK-PNLASE  200 (281)
Q Consensus       131 l~~g~~~~~~aLVV~~e~~s~~----~~----~~~~~fGDGAaA~ll~~~~~~-~i~~~~~~s~~~~~~~~~~-p~~~~~  200 (281)
                      +++|+.  ++||||++|.++..    +.    .+..+|||||+|+||++++.. .+........+.. ...+. +..+..
T Consensus       168 l~sg~~--~~~LVV~~E~~s~~~~~~d~~~~~~~~~lfGDGAaA~ll~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  244 (372)
T d1teda_         168 VRAHPA--MKALVVCIELCSVNAVFADDINDVVIHSLFGDGCAALVIGASQVQEKLEPGKVVVRSSF-SQLLDNTEDGIV  244 (372)
T ss_dssp             HHHSTT--CEEEEEEEEECGGGCCCCSSHHHHHHHHHBCEEEEEEEEEEECTTSCCCTTCEEEEEEE-EEECTTCTTSEE
T ss_pred             HhcCCC--ccceeeeehhhcccccCCCcchhhhhhhhhcccceeEEeccCCcccccCCceeEEeccc-ccccCCCccccc
Confidence            999954  99999999998732    11    235799999999999987642 2221111111110 01111 000001


Q ss_pred             ccCCCCc----ccHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCcEEecCCCChhHHHHHHHhccchhhhhcCCC---c
Q 023511          201 YPVVDGK----LSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNARL---P  273 (281)
Q Consensus       201 ~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~did~~i~Hq~n~~i~~~~~~~lg~~~~~~~~~~---~  273 (281)
                      +...+..    .....+....+.+.+.+.   +.|+++|++++|||+|++||+|.+|++.+.++||+++++...++   +
T Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~---~~L~~~gl~~~did~~i~Hq~~~~i~~~i~~~Lgl~~ek~~~s~~~l~  321 (372)
T d1teda_         245 LGVNHNGITCELSENLPGYIFSGVAPVVT---EMLWDNGLQISDIDLWAIHPGGPKIIEQSVRSLGISAELAAQSWDVLA  321 (372)
T ss_dssp             EEEETTEEEEEECTTHHHHHHHHHHHHHH---HHHHHTTCCGGGCSCEEECCSCHHHHHHHHHHHTCCGGGGHHHHHHHH
T ss_pred             cCCCCCcceeechHHHHHHHHHHHHHHHH---HHHHhcCCCHHHhhhhhccCccHHHHHHHHHHcCCCHHHhhhhHHHHh
Confidence            1111111    112344444444444444   46889999999999999999999999999999999999976664   4


Q ss_pred             cccccC
Q 023511          274 SFLHLS  279 (281)
Q Consensus       274 ~~~~~~  279 (281)
                      +|||++
T Consensus       322 ~~GN~~  327 (372)
T d1teda_         322 RFGNML  327 (372)
T ss_dssp             HHCBCT
T ss_pred             ccCCcH
Confidence            678875
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Back     information, alignment and structure
>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure