Citrus Sinensis ID: 023558

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280

MSSLWSLAPCKITLWEHYPVQPSRLSLKLAISNASENKNHSLPLKLCCCDSSDSTAVIGSTNNNSAPPVMRKKKRVRYRREYPGESKGITEEMRFVAMRLRNLKGKKYPSSPHNSNSDCEDSSNDDVEHEQEVKQDNDGETWKPSMDAFVKYLVDSQLVFNTIERIVDDSNDVAYAYFRKTGLERSEGISRDLEWFSEQGIIIPEPSTPGVSYAKYLEELAEKSAPLFLSHFYNIYFSHVAGGQVIERQHWTRDEKNKSLKEAAKSFKFLGQIVRLIILL

ccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccHccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcc

***LWSLAPCKITLWEHYPVQPSRLSLKLAI*********SLPLKLCCCD*************************************GITEEMRFVAMRL********************************************SMDAFVKYLVDSQLVFNTIERIVDDSNDVAYAYFRKTGLERSEGISRDLEWFSEQGIIIPEPSTPGVSYAKYLEELAEKSAPLFLSHFYNIYFSHVAGGQVIERQHWTR****KSLKEAAKSFKFLGQIVRLIILL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable inactive heme oxygenase 2, chloroplastic	Probable inactive heme oxygenase. Binds protoporphyrin IX, a precursor for both heme and chlorophyll biosynthesis. Plays a minor role in phytochrome assembly and photomorphogenesis.	probable	O48722

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WZD, chain A
Confidence level:very confident
Coverage over the Query: 88-108,135-278
View the alignment between query and template
View the model in PyMOL