Citrus Sinensis ID: 023561
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 280 | ||||||
| 255539138 | 386 | alcohol dehydrogenase, putative [Ricinus | 0.914 | 0.663 | 0.742 | 1e-111 | |
| 225459818 | 384 | PREDICTED: alcohol dehydrogenase-like 7 | 0.942 | 0.687 | 0.708 | 1e-110 | |
| 7705214 | 389 | alcohol dehydrogenase ADH [Solanum lycop | 0.964 | 0.694 | 0.7 | 1e-109 | |
| 7705215 | 390 | alcohol dehydrogenase ADH [Solanum lycop | 0.939 | 0.674 | 0.714 | 1e-108 | |
| 359492331 | 395 | PREDICTED: alcohol dehydrogenase-like 7- | 0.939 | 0.665 | 0.695 | 1e-108 | |
| 224065707 | 398 | predicted protein [Populus trichocarpa] | 0.942 | 0.663 | 0.762 | 1e-107 | |
| 297795321 | 390 | hypothetical protein ARALYDRAFT_494804 [ | 0.921 | 0.661 | 0.702 | 1e-106 | |
| 356554319 | 387 | PREDICTED: alcohol dehydrogenase-like 7- | 0.946 | 0.684 | 0.694 | 1e-105 | |
| 356554321 | 388 | PREDICTED: alcohol dehydrogenase-like 7- | 0.957 | 0.690 | 0.690 | 1e-105 | |
| 15238330 | 390 | alcohol dehydrogenase-like 7 [Arabidopsi | 0.939 | 0.674 | 0.696 | 1e-105 |
| >gi|255539138|ref|XP_002510634.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223551335|gb|EEF52821.1| alcohol dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 407 bits (1045), Expect = e-111, Method: Compositional matrix adjust.
Identities = 190/256 (74%), Positives = 221/256 (86%)
Query: 10 TAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAV 69
+ G PI+C+AA+ PGEPLVI+E++V PPN HEVR++IICTSLC SD+TFW++KDFPAV
Sbjct: 8 SVGTPIRCKAAVCRKPGEPLVIEEILVAPPNRHEVRIQIICTSLCQSDITFWRLKDFPAV 67
Query: 70 FPRILGHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISP 129
FPRILGHEA+GVVESVGE+V EGD VIP FL DC +C C SKK NLCS PFK+SP
Sbjct: 68 FPRILGHEAVGVVESVGEDVKEFKEGDTVIPTFLPDCGDCTDCISKKSNLCSKLPFKVSP 127
Query: 130 WMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTG 189
WMPR +TSRF DL GE ++HF+SVSSFS+YTV+DIAH+ KVDP++PPNRACLLSCGVSTG
Sbjct: 128 WMPRYETSRFTDLNGEALYHFLSVSSFSQYTVIDIAHLTKVDPSIPPNRACLLSCGVSTG 187
Query: 190 VGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTE 249
VGAAWRTANVE GSTVVIFGLGSIGLAVAEGARLCGATRIIGVD KFEIGK+FGVTE
Sbjct: 188 VGAAWRTANVEAGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDTNPNKFEIGKKFGVTE 247
Query: 250 FVNSKNCGDKSVSQVL 265
FV++ + G+KS SQV+
Sbjct: 248 FVSAGDLGNKSASQVI 263
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225459818|ref|XP_002285916.1| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera] gi|302141683|emb|CBI18886.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|7705214|gb|AAB33480.2| alcohol dehydrogenase ADH [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|7705215|gb|AAB33481.2| alcohol dehydrogenase ADH [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|359492331|ref|XP_002285917.2| PREDICTED: alcohol dehydrogenase-like 7-like [Vitis vinifera] gi|302141684|emb|CBI18887.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224065707|ref|XP_002301931.1| predicted protein [Populus trichocarpa] gi|222843657|gb|EEE81204.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297795321|ref|XP_002865545.1| hypothetical protein ARALYDRAFT_494804 [Arabidopsis lyrata subsp. lyrata] gi|297311380|gb|EFH41804.1| hypothetical protein ARALYDRAFT_494804 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356554319|ref|XP_003545495.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356554321|ref|XP_003545496.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15238330|ref|NP_199040.1| alcohol dehydrogenase-like 7 [Arabidopsis thaliana] gi|75333830|sp|Q9FH04.1|ADHL7_ARATH RecName: Full=Alcohol dehydrogenase-like 7 gi|10177010|dbj|BAB10198.1| alcohol dehydrogenase [Arabidopsis thaliana] gi|19698971|gb|AAL91221.1| alcohol dehydrogenase [Arabidopsis thaliana] gi|22136298|gb|AAM91227.1| alcohol dehydrogenase [Arabidopsis thaliana] gi|332007405|gb|AED94788.1| alcohol dehydrogenase-like 7 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 280 | ||||||
| TAIR|locus:2157627 | 390 | AT5G42250 [Arabidopsis thalian | 0.939 | 0.674 | 0.636 | 9.3e-91 | |
| TAIR|locus:2009512 | 386 | AT1G22440 [Arabidopsis thalian | 0.935 | 0.678 | 0.556 | 5.7e-75 | |
| TAIR|locus:2009522 | 388 | AT1G22430 [Arabidopsis thalian | 0.907 | 0.654 | 0.546 | 5.9e-73 | |
| TAIR|locus:2120663 | 389 | AT4G22110 [Arabidopsis thalian | 0.907 | 0.652 | 0.554 | 7.5e-73 | |
| TAIR|locus:2025237 | 379 | ADH1 "alcohol dehydrogenase 1" | 0.925 | 0.683 | 0.446 | 1.2e-56 | |
| TAIR|locus:2035619 | 394 | AT1G32780 [Arabidopsis thalian | 0.925 | 0.657 | 0.462 | 2.5e-56 | |
| ZFIN|ZDB-GENE-011003-1 | 376 | adh5 "alcohol dehydrogenase 5" | 0.925 | 0.688 | 0.448 | 6.1e-55 | |
| ZFIN|ZDB-GENE-040426-1165 | 380 | zgc:63568 "zgc:63568" [Danio r | 0.903 | 0.665 | 0.452 | 3.4e-54 | |
| TAIR|locus:2184575 | 381 | AT5G24760 [Arabidopsis thalian | 0.878 | 0.645 | 0.438 | 4.3e-54 | |
| ZFIN|ZDB-GENE-040426-1910 | 378 | zgc:77938 "zgc:77938" [Danio r | 0.910 | 0.674 | 0.438 | 1.7e-52 |
| TAIR|locus:2157627 AT5G42250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 905 (323.6 bits), Expect = 9.3e-91, P = 9.3e-91
Identities = 168/264 (63%), Positives = 206/264 (78%)
Query: 8 NKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFP 67
NK++ KPI+C+AA++ GEPLV++E++V PP EVR+RIICT+LCHSDVTFWK++ P
Sbjct: 10 NKSSHKPIRCKAAVSRKAGEPLVMEEIMVAPPQPFEVRIRIICTALCHSDVTFWKLQVPP 69
Query: 68 AVFPRILGHEAIXXXXXXXXXXXXXXXXXXXIPHFLADCTECVGCRSKKGNLCSAFPFKI 127
A FPRILGHEAI +P F+ DC +CV C+S K NLCS FPFK+
Sbjct: 70 ACFPRILGHEAIGVVESVGENVKEVVEGDTVLPTFMPDCGDCVDCKSHKSNLCSKFPFKV 129
Query: 128 SPWMPR-DQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGV 186
SPWMPR D +SRF DL GET+ HF++VSSFSEYTVLD+A+VVK+D ++PP+RACLLSCGV
Sbjct: 130 SPWMPRYDNSSRFTDLNGETLFHFLNVSSFSEYTVLDVANVVKIDSSIPPSRACLLSCGV 189
Query: 187 STGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFG 246
STGVGAAW TA VE GSTVVIFGLGSIGLAVAEGARLCGA+RIIGVD+ KF++G++FG
Sbjct: 190 STGVGAAWETAKVEKGSTVVIFGLGSIGLAVAEGARLCGASRIIGVDINPTKFQVGQKFG 249
Query: 247 VTEFVNSKNCGDKSVSQVLLSIYD 270
VTEFVNS C VS+V+ + D
Sbjct: 250 VTEFVNSMTCEKNRVSEVINEMTD 273
|
|
| TAIR|locus:2009512 AT1G22440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009522 AT1G22430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120663 AT4G22110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025237 ADH1 "alcohol dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035619 AT1G32780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-011003-1 adh5 "alcohol dehydrogenase 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1165 zgc:63568 "zgc:63568" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184575 AT5G24760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1910 zgc:77938 "zgc:77938" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00015543001 | SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (395 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00036847001 | • | 0.899 | |||||||||
| GSVIVG00035907001 | • | 0.899 | |||||||||
| GSVIVG00034061001 | • | 0.899 | |||||||||
| GSVIVG00028844001 | • | 0.899 | |||||||||
| GSVIVG00024617001 | • | 0.899 | |||||||||
| GSVIVG00024065001 | • | 0.899 | |||||||||
| GSVIVG00020768001 | • | 0.899 | |||||||||
| GSVIVG00019283001 | • | 0.899 | |||||||||
| GSVIVG00016425001 | • | 0.899 | |||||||||
| GSVIVG00016121001 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 280 | |||
| cd08301 | 369 | cd08301, alcohol_DH_plants, Plant alcohol dehydrog | 1e-136 | |
| cd08277 | 365 | cd08277, liver_alcohol_DH_like, Liver alcohol dehy | 1e-110 | |
| PLN02740 | 381 | PLN02740, PLN02740, Alcohol dehydrogenase-like | 1e-109 | |
| cd08300 | 368 | cd08300, alcohol_DH_class_III, class III alcohol d | 1e-107 | |
| PLN02827 | 378 | PLN02827, PLN02827, Alcohol dehydrogenase-like | 5e-91 | |
| cd08299 | 373 | cd08299, alcohol_DH_class_I_II_IV, class I, II, IV | 4e-88 | |
| COG1062 | 366 | COG1062, AdhC, Zn-dependent alcohol dehydrogenases | 2e-85 | |
| cd05279 | 365 | cd05279, Zn_ADH1, Liver alcohol dehydrogenase and | 1e-82 | |
| cd08279 | 363 | cd08279, Zn_ADH_class_III, Class III alcohol dehyd | 2e-82 | |
| TIGR02818 | 368 | TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat | 2e-80 | |
| cd08278 | 365 | cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro | 2e-62 | |
| TIGR03989 | 369 | TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa | 1e-58 | |
| cd08281 | 371 | cd08281, liver_ADH_like1, Zinc-dependent alcohol d | 2e-53 | |
| TIGR03451 | 358 | TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi | 2e-47 | |
| cd08263 | 367 | cd08263, Zn_ADH10, Alcohol dehydrogenases of the M | 2e-42 | |
| cd05188 | 271 | cd05188, MDR, Medium chain reductase/dehydrogenase | 6e-41 | |
| COG1064 | 339 | COG1064, AdhP, Zn-dependent alcohol dehydrogenases | 7e-41 | |
| COG1063 | 350 | COG1063, Tdh, Threonine dehydrogenase and related | 7e-34 | |
| cd08285 | 351 | cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd | 2e-32 | |
| cd08254 | 338 | cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e | 2e-32 | |
| cd08234 | 334 | cd08234, threonine_DH_like, L-threonine dehydrogen | 6e-32 | |
| cd08260 | 345 | cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD | 2e-31 | |
| cd08236 | 343 | cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog | 4e-31 | |
| cd08297 | 341 | cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA | 7e-31 | |
| cd08235 | 343 | cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas | 3e-29 | |
| cd08231 | 361 | cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 | 3e-29 | |
| cd08261 | 337 | cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD | 6e-29 | |
| cd05285 | 343 | cd05285, sorbitol_DH, Sorbitol dehydrogenase | 8e-29 | |
| cd08259 | 332 | cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD | 6e-28 | |
| cd05278 | 347 | cd05278, FDH_like, Formaldehyde dehydrogenases | 6e-28 | |
| cd08240 | 350 | cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa | 3e-27 | |
| cd05284 | 340 | cd05284, arabinose_DH_like, D-arabinose dehydrogen | 4e-27 | |
| cd08239 | 339 | cd08239, THR_DH_like, L-threonine dehydrogenase (T | 4e-27 | |
| cd08232 | 339 | cd08232, idonate-5-DH, L-idonate 5-dehydrogenase | 3e-25 | |
| PRK13771 | 334 | PRK13771, PRK13771, putative alcohol dehydrogenase | 6e-25 | |
| cd08245 | 330 | cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD | 1e-24 | |
| cd08298 | 329 | cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA | 2e-24 | |
| cd08283 | 386 | cd08283, FDH_like_1, Glutathione-dependent formald | 5e-23 | |
| cd08258 | 306 | cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD | 7e-23 | |
| pfam08240 | 108 | pfam08240, ADH_N, Alcohol dehydrogenase GroES-like | 1e-22 | |
| cd08233 | 351 | cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio | 5e-22 | |
| cd08286 | 345 | cd08286, FDH_like_ADH2, formaldehyde dehydrogenase | 7e-22 | |
| cd05283 | 337 | cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA | 1e-21 | |
| cd08287 | 345 | cd08287, FDH_like_ADH3, formaldehyde dehydrogenase | 2e-20 | |
| cd05281 | 341 | cd05281, TDH, Threonine dehydrogenase | 2e-20 | |
| cd08269 | 312 | cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD | 6e-20 | |
| TIGR00692 | 340 | TIGR00692, tdh, L-threonine 3-dehydrogenase | 4e-19 | |
| PRK05396 | 341 | PRK05396, tdh, L-threonine 3-dehydrogenase; Valida | 3e-18 | |
| cd08266 | 342 | cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t | 6e-18 | |
| PRK10309 | 347 | PRK10309, PRK10309, galactitol-1-phosphate dehydro | 7e-18 | |
| COG0604 | 326 | COG0604, Qor, NADPH:quinone reductase and related | 9e-18 | |
| PLN02702 | 364 | PLN02702, PLN02702, L-idonate 5-dehydrogenase | 1e-17 | |
| cd08296 | 333 | cd08296, CAD_like, Cinnamyl alcohol dehydrogenases | 4e-17 | |
| cd08284 | 344 | cd08284, FDH_like_2, Glutathione-dependent formald | 5e-17 | |
| cd08265 | 384 | cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD | 7e-17 | |
| TIGR03201 | 349 | TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 | 2e-16 | |
| PRK10083 | 339 | PRK10083, PRK10083, putative oxidoreductase; Provi | 5e-16 | |
| PRK09422 | 338 | PRK09422, PRK09422, ethanol-active dehydrogenase/a | 6e-16 | |
| cd08256 | 350 | cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD | 1e-15 | |
| cd05289 | 309 | cd05289, MDR_like_2, alcohol dehydrogenase and qui | 2e-14 | |
| cd08264 | 325 | cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t | 8e-13 | |
| cd08255 | 277 | cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro | 4e-12 | |
| cd08230 | 355 | cd08230, glucose_DH, Glucose dehydrogenase | 4e-12 | |
| cd08249 | 339 | cd08249, enoyl_reductase_like, enoyl_reductase_lik | 7e-12 | |
| cd08282 | 375 | cd08282, PFDH_like, Pseudomonas putida aldehyde-di | 8e-12 | |
| TIGR02819 | 393 | TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas | 2e-10 | |
| cd08241 | 323 | cd08241, QOR1, Quinone oxidoreductase (QOR) | 3e-10 | |
| cd08276 | 336 | cd08276, MDR7, Medium chain dehydrogenases/reducta | 4e-10 | |
| cd08272 | 326 | cd08272, MDR6, Medium chain dehydrogenases/reducta | 5e-10 | |
| PRK09880 | 343 | PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro | 2e-09 | |
| TIGR03366 | 280 | TIGR03366, HpnZ_proposed, putative phosphonate cat | 2e-09 | |
| cd08268 | 328 | cd08268, MDR2, Medium chain dehydrogenases/reducta | 2e-09 | |
| cd08273 | 331 | cd08273, MDR8, Medium chain dehydrogenases/reducta | 3e-09 | |
| cd05286 | 320 | cd05286, QOR2, Quinone oxidoreductase (QOR) | 1e-08 | |
| cd08262 | 341 | cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD | 2e-08 | |
| cd08271 | 325 | cd08271, MDR5, Medium chain dehydrogenases/reducta | 3e-08 | |
| cd08282 | 375 | cd08282, PFDH_like, Pseudomonas putida aldehyde-di | 6e-08 | |
| cd08243 | 320 | cd08243, quinone_oxidoreductase_like_1, Quinone ox | 9e-08 | |
| pfam00107 | 131 | pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase | 2e-07 | |
| cd08292 | 324 | cd08292, ETR_like_2, 2-enoyl thioester reductase ( | 2e-07 | |
| cd08267 | 319 | cd08267, MDR1, Medium chain dehydrogenases/reducta | 2e-07 | |
| cd08290 | 341 | cd08290, ETR, 2-enoyl thioester reductase (ETR) | 3e-07 | |
| PLN02178 | 375 | PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase | 3e-07 | |
| cd05282 | 323 | cd05282, ETR_like, 2-enoyl thioester reductase-lik | 4e-07 | |
| cd08242 | 319 | cd08242, MDR_like, Medium chain dehydrogenases/red | 8e-07 | |
| PLN02514 | 357 | PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase | 8e-07 | |
| PLN02586 | 360 | PLN02586, PLN02586, probable cinnamyl alcohol dehy | 1e-06 | |
| cd08253 | 325 | cd08253, zeta_crystallin, Zeta-crystallin with NAD | 2e-05 | |
| cd08274 | 350 | cd08274, MDR9, Medium chain dehydrogenases/reducta | 1e-04 | |
| cd08291 | 324 | cd08291, ETR_like_1, 2-enoyl thioester reductase ( | 3e-04 | |
| cd08238 | 410 | cd08238, sorbose_phosphate_red, L-sorbose-1-phosph | 4e-04 | |
| cd05300 | 313 | cd05300, 2-Hacid_dh_1, Putative D-isomer specific | 5e-04 | |
| TIGR02822 | 329 | TIGR02822, adh_fam_2, zinc-binding alcohol dehydro | 0.001 | |
| PTZ00354 | 334 | PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi | 0.001 | |
| cd05276 | 323 | cd05276, p53_inducible_oxidoreductase, PIG3 p53-in | 0.001 | |
| cd08252 | 336 | cd08252, AL_MDR, Arginate lyase and other MDR fami | 0.002 | |
| cd08250 | 329 | cd08250, Mgc45594_like, Mgc45594 gene product and | 0.004 |
| >gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
Score = 389 bits (1002), Expect = e-136
Identities = 139/252 (55%), Positives = 177/252 (70%), Gaps = 3/252 (1%)
Query: 15 IQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRIL 74
I C+AA+A G+PLVI+EV V PP + EVR++I+ TSLCH+DV FW+ K +FPRIL
Sbjct: 1 ITCKAAVAWEAGKPLVIEEVEVAPPQAMEVRIKILHTSLCHTDVYFWEAKGQTPLFPRIL 60
Query: 75 GHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPW-MPR 133
GHEA G+VESVGE V + GD V+P F +C EC C+S+K N+C M
Sbjct: 61 GHEAAGIVESVGEGVTDLKPGDHVLPVFTGECKECRHCKSEKSNMCDLLRINTDRGVMIN 120
Query: 134 DQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTGVGAA 193
D SRF G+ I+HFV S+FSEYTV+ + V K++P P ++ CLLSCGVSTG+GAA
Sbjct: 121 DGKSRFSI-NGKPIYHFVGTSTFSEYTVVHVGCVAKINPEAPLDKVCLLSCGVSTGLGAA 179
Query: 194 WRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNS 253
W A V+ GSTV IFGLG++GLAVAEGAR+ GA+RIIGVD+ KFE K+FGVTEFVN
Sbjct: 180 WNVAKVKKGSTVAIFGLGAVGLAVAEGARIRGASRIIGVDLNPSKFEQAKKFGVTEFVNP 239
Query: 254 KNCGDKSVSQVL 265
K+ DK V +V+
Sbjct: 240 KDH-DKPVQEVI 250
|
NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the substrate binding pocket and therefore in substrate specificity. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48) , then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 369 |
| >gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family | Back alignment and domain information |
|---|
| >gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like | Back alignment and domain information |
|---|
| >gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 100.0 | |
| COG1062 | 366 | AdhC Zn-dependent alcohol dehydrogenases, class II | 100.0 | |
| KOG0022 | 375 | consensus Alcohol dehydrogenase, class III [Second | 100.0 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 100.0 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 100.0 | |
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 100.0 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 100.0 | |
| cd08300 | 368 | alcohol_DH_class_III class III alcohol dehydrogena | 100.0 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 100.0 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 100.0 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 100.0 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 100.0 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 100.0 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 100.0 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 100.0 | |
| TIGR02819 | 393 | fdhA_non_GSH formaldehyde dehydrogenase, glutathio | 100.0 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 100.0 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 100.0 | |
| cd08299 | 373 | alcohol_DH_class_I_II_IV class I, II, IV alcohol d | 100.0 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 100.0 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 100.0 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 100.0 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 100.0 | |
| cd08278 | 365 | benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be | 100.0 | |
| cd05279 | 365 | Zn_ADH1 Liver alcohol dehydrogenase and related zi | 100.0 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 100.0 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 100.0 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 100.0 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 100.0 | |
| KOG1197 | 336 | consensus Predicted quinone oxidoreductase [Energy | 100.0 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 100.0 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 100.0 | |
| cd05278 | 347 | FDH_like Formaldehyde dehydrogenases. Formaldehyde | 100.0 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 100.0 | |
| cd05284 | 340 | arabinose_DH_like D-arabinose dehydrogenase. This | 100.0 | |
| PRK10083 | 339 | putative oxidoreductase; Provisional | 100.0 | |
| cd08256 | 350 | Zn_ADH2 Alcohol dehydrogenases of the MDR family. | 100.0 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 100.0 | |
| cd08279 | 363 | Zn_ADH_class_III Class III alcohol dehydrogenase. | 100.0 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 100.0 | |
| cd08286 | 345 | FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik | 100.0 | |
| cd08240 | 350 | 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy | 100.0 | |
| cd08246 | 393 | crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- | 100.0 | |
| cd08260 | 345 | Zn_ADH6 Alcohol dehydrogenases of the MDR family. | 100.0 | |
| PRK09422 | 338 | ethanol-active dehydrogenase/acetaldehyde-active r | 100.0 | |
| cd08238 | 410 | sorbose_phosphate_red L-sorbose-1-phosphate reduct | 100.0 | |
| cd08263 | 367 | Zn_ADH10 Alcohol dehydrogenases of the MDR family. | 100.0 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 100.0 | |
| cd08265 | 384 | Zn_ADH3 Alcohol dehydrogenases of the MDR family. | 100.0 | |
| cd08282 | 375 | PFDH_like Pseudomonas putida aldehyde-dismutating | 100.0 | |
| cd08261 | 337 | Zn_ADH7 Alcohol dehydrogenases of the MDR family. | 100.0 | |
| cd08284 | 344 | FDH_like_2 Glutathione-dependent formaldehyde dehy | 100.0 | |
| cd08287 | 345 | FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik | 100.0 | |
| cd08235 | 343 | iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ | 100.0 | |
| TIGR01751 | 398 | crot-CoA-red crotonyl-CoA reductase. The enzyme mo | 100.0 | |
| PRK13771 | 334 | putative alcohol dehydrogenase; Provisional | 100.0 | |
| PLN02702 | 364 | L-idonate 5-dehydrogenase | 100.0 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 100.0 | |
| cd05285 | 343 | sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a | 100.0 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 100.0 | |
| cd08297 | 341 | CAD3 Cinnamyl alcohol dehydrogenases (CAD). These | 100.0 | |
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 100.0 | |
| cd05283 | 337 | CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam | 99.98 | |
| cd08291 | 324 | ETR_like_1 2-enoyl thioester reductase (ETR) like | 99.98 | |
| cd08245 | 330 | CAD Cinnamyl alcohol dehydrogenases (CAD) and rela | 99.98 | |
| cd08266 | 342 | Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam | 99.98 | |
| cd05281 | 341 | TDH Threonine dehydrogenase. L-threonine dehydroge | 99.97 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 99.97 | |
| cd08236 | 343 | sugar_DH NAD(P)-dependent sugar dehydrogenases. Th | 99.97 | |
| cd08298 | 329 | CAD2 Cinnamyl alcohol dehydrogenases (CAD). These | 99.97 | |
| cd08262 | 341 | Zn_ADH8 Alcohol dehydrogenases of the MDR family. | 99.97 | |
| cd08234 | 334 | threonine_DH_like L-threonine dehydrogenase. L-thr | 99.97 | |
| cd08258 | 306 | Zn_ADH4 Alcohol dehydrogenases of the MDR family. | 99.97 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 99.97 | |
| TIGR00692 | 340 | tdh L-threonine 3-dehydrogenase. E. coli His-90 mo | 99.97 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 99.97 | |
| cd08232 | 339 | idonate-5-DH L-idonate 5-dehydrogenase. L-idonate | 99.97 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 99.97 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 99.97 | |
| TIGR02817 | 336 | adh_fam_1 zinc-binding alcohol dehydrogenase famil | 99.97 | |
| PRK10754 | 327 | quinone oxidoreductase, NADPH-dependent; Provision | 99.97 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 99.97 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 99.97 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 99.97 | |
| cd08290 | 341 | ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi | 99.96 | |
| KOG0025 | 354 | consensus Zn2+-binding dehydrogenase (nuclear rece | 99.96 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 99.96 | |
| cd08276 | 336 | MDR7 Medium chain dehydrogenases/reductase (MDR)/z | 99.96 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 99.96 | |
| cd08249 | 339 | enoyl_reductase_like enoyl_reductase_like. Member | 99.96 | |
| PTZ00354 | 334 | alcohol dehydrogenase; Provisional | 99.96 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 99.96 | |
| cd05280 | 325 | MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone | 99.96 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 99.96 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 99.96 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 99.95 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 99.95 | |
| cd08248 | 350 | RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu | 99.95 | |
| cd08252 | 336 | AL_MDR Arginate lyase and other MDR family members | 99.95 | |
| TIGR02823 | 323 | oxido_YhdH putative quinone oxidoreductase, YhdH/Y | 99.95 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 99.95 | |
| cd08271 | 325 | MDR5 Medium chain dehydrogenases/reductase (MDR)/z | 99.95 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 99.95 | |
| cd08288 | 324 | MDR_yhdh Yhdh putative quinone oxidoreductases. Yh | 99.95 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 99.95 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 99.94 | |
| cd08269 | 312 | Zn_ADH9 Alcohol dehydrogenases of the MDR family. | 99.94 | |
| cd08272 | 326 | MDR6 Medium chain dehydrogenases/reductase (MDR)/z | 99.94 | |
| cd08247 | 352 | AST1_like AST1 is a cytoplasmic protein associated | 99.94 | |
| cd05286 | 320 | QOR2 Quinone oxidoreductase (QOR). Quinone oxidore | 99.94 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 99.94 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 99.94 | |
| cd08273 | 331 | MDR8 Medium chain dehydrogenases/reductase (MDR)/z | 99.94 | |
| cd05288 | 329 | PGDH Prostaglandin dehydrogenases. Prostaglandins | 99.93 | |
| TIGR02824 | 325 | quinone_pig3 putative NAD(P)H quinone oxidoreducta | 99.93 | |
| cd08251 | 303 | polyketide_synthase polyketide synthase. Polyketid | 99.93 | |
| cd05289 | 309 | MDR_like_2 alcohol dehydrogenase and quinone reduc | 99.92 | |
| cd08241 | 323 | QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t | 99.92 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 99.92 | |
| cd08267 | 319 | MDR1 Medium chain dehydrogenases/reductase (MDR)/z | 99.91 | |
| cd08275 | 337 | MDR3 Medium chain dehydrogenases/reductase (MDR)/z | 99.91 | |
| cd05195 | 293 | enoyl_red enoyl reductase of polyketide synthase. | 99.91 | |
| PF08240 | 109 | ADH_N: Alcohol dehydrogenase GroES-like domain; In | 99.89 | |
| smart00829 | 288 | PKS_ER Enoylreductase. Enoylreductase in Polyketid | 99.89 | |
| cd08255 | 277 | 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ | 99.77 | |
| KOG1196 | 343 | consensus Predicted NAD-dependent oxidoreductase [ | 99.76 | |
| KOG1202 | 2376 | consensus Animal-type fatty acid synthase and rela | 99.65 | |
| PF00107 | 130 | ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: | 98.79 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 98.19 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 97.51 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 97.51 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 97.27 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 97.05 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 96.92 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 96.82 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 96.69 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.69 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 96.59 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 96.47 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 96.44 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 96.43 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 96.34 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 96.22 | |
| PLN02494 | 477 | adenosylhomocysteinase | 96.13 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 95.99 | |
| PF11017 | 314 | DUF2855: Protein of unknown function (DUF2855); In | 95.96 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 95.85 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 95.84 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.65 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 95.59 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 95.58 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 95.56 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 95.52 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 95.49 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.37 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 95.25 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 95.21 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 95.18 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 95.16 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 95.15 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 95.15 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 95.09 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 95.04 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 95.01 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 95.0 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 94.95 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 94.9 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 94.88 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 94.87 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 94.86 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 94.8 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 94.79 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 94.78 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 94.7 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.7 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.67 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 94.62 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 94.61 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 94.6 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.56 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 94.5 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 94.5 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 94.45 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 94.45 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 94.39 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 94.34 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 94.17 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 94.12 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 94.1 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 94.06 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 94.06 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 94.03 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.03 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.0 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 93.99 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 93.94 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 93.91 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 93.88 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 93.87 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 93.84 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 93.84 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 93.84 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 93.83 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 93.82 | |
| COG0031 | 300 | CysK Cysteine synthase [Amino acid transport and m | 93.82 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 93.82 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 93.77 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 93.77 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 93.74 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 93.73 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.72 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 93.65 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 93.64 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 93.62 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 93.61 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 93.59 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 93.58 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 93.55 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.54 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 93.52 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.51 | |
| PRK05717 | 255 | oxidoreductase; Validated | 93.42 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 93.4 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 93.39 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 93.37 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 93.32 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 93.32 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 93.31 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 93.25 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 93.23 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 93.2 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 93.17 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 93.15 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 93.14 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 93.14 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 93.14 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 93.14 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 93.13 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 93.12 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 93.11 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 93.05 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 93.04 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 93.03 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 93.02 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 92.99 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.99 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 92.95 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 92.88 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 92.83 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 92.8 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 92.77 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 92.68 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 92.68 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 92.67 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 92.66 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 92.61 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 92.6 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 92.59 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 92.55 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 92.55 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 92.54 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 92.52 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 92.51 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 92.5 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 92.49 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 92.45 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 92.44 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 92.37 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 92.35 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 92.35 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 92.33 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 92.31 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 92.3 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 92.29 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 92.18 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 92.17 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 92.16 | |
| PRK08643 | 256 | acetoin reductase; Validated | 92.13 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 92.11 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 92.06 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 92.03 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 91.98 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 91.98 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 91.95 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 91.9 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 91.89 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 91.85 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 91.84 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 91.84 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 91.83 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 91.81 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 91.8 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.77 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 91.73 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 91.67 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.66 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 91.63 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 91.58 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 91.55 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 91.54 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 91.49 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 91.44 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.38 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 91.37 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.36 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 91.3 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 91.29 | |
| PF13823 | 23 | ADH_N_assoc: Alcohol dehydrogenase GroES-associate | 91.28 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 91.27 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 91.18 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.14 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 91.14 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 91.0 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 91.0 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 90.92 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 90.89 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 90.75 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 90.72 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 90.71 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.7 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 90.67 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.65 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 90.63 | |
| PLN02366 | 308 | spermidine synthase | 90.62 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 90.61 | |
| PRK11761 | 296 | cysM cysteine synthase B; Provisional | 90.6 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 90.56 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 90.53 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 90.53 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 90.52 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 90.48 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 90.4 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 90.35 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 90.25 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 90.23 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 90.22 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.12 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 90.11 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 90.08 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 90.07 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 90.02 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 90.01 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.97 | |
| PLN03013 | 429 | cysteine synthase | 89.93 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 89.91 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.89 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 89.86 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 89.77 | |
| KOG1252 | 362 | consensus Cystathionine beta-synthase and related | 89.73 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 89.67 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.63 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 89.6 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 89.57 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 89.57 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 89.48 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.4 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 89.32 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 89.24 | |
| TIGR01138 | 290 | cysM cysteine synthase B. Alternate name: O-acetyl | 89.22 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 89.19 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 89.11 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.99 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 88.88 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.85 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 88.76 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 88.72 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 88.72 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 88.71 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 88.7 | |
| PLN02565 | 322 | cysteine synthase | 88.68 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.61 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 88.59 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 88.57 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 88.45 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 88.4 | |
| PLN02823 | 336 | spermine synthase | 88.38 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 88.38 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 88.38 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 88.33 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 88.29 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 88.24 | |
| KOG2304 | 298 | consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t | 88.23 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 88.23 | |
| TIGR01136 | 299 | cysKM cysteine synthases. This model discriminates | 88.21 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 88.19 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 88.13 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 88.12 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 88.1 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.98 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 87.94 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 87.91 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 87.88 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 87.87 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 87.87 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 87.86 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 87.86 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 87.86 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 87.84 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 87.83 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 87.82 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 87.81 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 87.78 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.76 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 87.74 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 87.7 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 87.67 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.66 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 87.64 | |
| PLN02556 | 368 | cysteine synthase/L-3-cyanoalanine synthase | 87.61 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 87.57 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 87.54 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 87.53 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 87.53 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 87.51 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 87.47 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 87.43 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 87.29 | |
| TIGR01139 | 298 | cysK cysteine synthase A. This model distinguishes | 87.21 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 87.2 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 87.13 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 87.13 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 87.05 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 87.01 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 87.0 | |
| KOG1207 | 245 | consensus Diacetyl reductase/L-xylulose reductase | 87.0 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 86.93 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 86.92 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.87 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 86.83 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 86.83 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 86.76 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 86.71 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 86.64 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 86.63 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 86.62 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 86.61 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 86.6 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 86.58 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 86.57 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 86.53 | |
| PLN02928 | 347 | oxidoreductase family protein | 86.48 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 86.45 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 86.37 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 86.36 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 86.18 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 86.15 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 86.11 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 86.11 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 86.1 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 86.05 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 86.02 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 86.02 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 85.99 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 85.98 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 85.95 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 85.85 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 85.76 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 85.72 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 85.68 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 85.67 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 85.67 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.56 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.56 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 85.56 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.52 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 85.5 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 85.45 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 85.43 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 85.41 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 85.4 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 85.39 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 85.38 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 85.37 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 85.32 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 85.31 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 85.27 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 85.25 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 85.24 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 85.24 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 85.21 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 85.2 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 85.14 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 85.13 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 85.04 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 85.03 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 84.97 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 84.96 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 84.93 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 84.92 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 84.87 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 84.85 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 84.83 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 84.81 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 84.79 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 84.53 | |
| cd01562 | 304 | Thr-dehyd Threonine dehydratase: The first step in | 84.45 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 84.3 | |
| PLN00011 | 323 | cysteine synthase | 84.28 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 84.27 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 84.26 |
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-52 Score=374.67 Aligned_cols=228 Identities=32% Similarity=0.483 Sum_probs=215.2
Q ss_pred cceeeeeeecCCCCCcEEEEeecCCCCCCeEEEEeeeeecChhhhhhhhcCCCCCCCCcccccceeEEEEEeCCCCCCCC
Q 023561 14 PIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRILGHEAIGVVESVGENVDGVV 93 (280)
Q Consensus 14 ~~~~~a~~~~~~g~~l~~~~~~~p~~~~~eVlIkv~~~~i~~~D~~~~~g~~~~~~~p~i~G~e~~G~V~~vG~~v~~~~ 93 (280)
|++|||+++.++++|++++|++.|+|+++||+|||+++|+|++|++.+.|.++...+|+++|||.+|+|+++|++|+.|+
T Consensus 1 ~~~mkA~~~~~~~~pl~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~~P~ipGHEivG~V~~vG~~V~~~k 80 (339)
T COG1064 1 MMTMKAAVLKKFGQPLEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPKLPLIPGHEIVGTVVEVGEGVTGLK 80 (339)
T ss_pred CcceEEEEEccCCCCceEEeccCCCCCCCeEEEEEEEEeecchhhhhhcCCCCCCCCCccCCcceEEEEEEecCCCccCC
Confidence 46899999999999999999999999999999999999999999999999999888999999999999999999999999
Q ss_pred CCCEEEe-cCCCCCCCChhhcCCCCCCCCCCCCCcCCCCCCCCCccccccCCceeecccccceeeeeEEeecccEEEcCC
Q 023561 94 EGDVVIP-HFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDP 172 (280)
Q Consensus 94 ~Gd~V~~-~~~~~c~~c~~c~~g~~~~c~~~~~~~~~g~~~~G~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~iP~ 172 (280)
+||||.+ +...+|++|.+|++|++++|++... .|++.+| +|+||+++++.+++++|+
T Consensus 81 ~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~---~gy~~~G-------------------Gyaeyv~v~~~~~~~iP~ 138 (339)
T COG1064 81 VGDRVGVGWLVISCGECEYCRSGNENLCPNQKI---TGYTTDG-------------------GYAEYVVVPARYVVKIPE 138 (339)
T ss_pred CCCEEEecCccCCCCCCccccCcccccCCCccc---cceeecC-------------------cceeEEEEchHHeEECCC
Confidence 9999988 8889999999999999999999775 6777777 999999999999999999
Q ss_pred CCChhhhcccchhhHHHHHHHHHHcCCCCCCEEEEECccHHHHHHHHHHHHcCCCeEEEEcCChhHHHHHHHcCCcEEEc
Q 023561 173 TVPPNRACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVN 252 (280)
Q Consensus 173 ~ls~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlI~G~g~~G~~a~~la~~~g~~~vi~~~~~~~~~~~~~~~Ga~~vi~ 252 (280)
++++++||.+.|++.|+|+++ +..++++|++|+|.|.|++|++++|+|+++|+ +|++++++++|+++++++|+++++|
T Consensus 139 ~~d~~~aApllCaGiT~y~al-k~~~~~pG~~V~I~G~GGlGh~avQ~Aka~ga-~Via~~~~~~K~e~a~~lGAd~~i~ 216 (339)
T COG1064 139 GLDLAEAAPLLCAGITTYRAL-KKANVKPGKWVAVVGAGGLGHMAVQYAKAMGA-EVIAITRSEEKLELAKKLGADHVIN 216 (339)
T ss_pred CCChhhhhhhhcCeeeEeeeh-hhcCCCCCCEEEEECCcHHHHHHHHHHHHcCC-eEEEEeCChHHHHHHHHhCCcEEEE
Confidence 999999999999999999976 55899999999999999999999999999997 9999999999999999999999999
Q ss_pred CCCCCCccHHHHHHHh
Q 023561 253 SKNCGDKSVSQVLLSI 268 (280)
Q Consensus 253 ~~~~~~~~~~~~v~~~ 268 (280)
..+ +++.+.+++.
T Consensus 217 ~~~---~~~~~~~~~~ 229 (339)
T COG1064 217 SSD---SDALEAVKEI 229 (339)
T ss_pred cCC---chhhHHhHhh
Confidence 766 6777777764
|
|
| >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd05278 FDH_like Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd05284 arabinose_DH_like D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >PRK10083 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >cd08246 crotonyl_coA_red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK05396 tdh L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01751 crot-CoA-red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK13771 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02702 L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >cd05285 sorbitol_DH Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05281 TDH Threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08234 threonine_DH_like L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >TIGR00692 tdh L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08232 idonate-5-DH L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >cd08290 ETR 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >cd08249 enoyl_reductase_like enoyl_reductase_like | Back alignment and domain information |
|---|
| >PTZ00354 alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd08252 AL_MDR Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >cd05286 QOR2 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05288 PGDH Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >cd08251 polyketide_synthase polyketide synthase | Back alignment and domain information |
|---|
| >cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >cd08241 QOR1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05195 enoyl_red enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 | Back alignment and domain information |
|---|
| >smart00829 PKS_ER Enoylreductase | Back alignment and domain information |
|---|
| >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK11761 cysM cysteine synthase B; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN03013 cysteine synthase | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01138 cysM cysteine synthase B | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02565 cysteine synthase | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01136 cysKM cysteine synthases | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02556 cysteine synthase/L-3-cyanoalanine synthase | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR01139 cysK cysteine synthase A | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PLN00011 cysteine synthase | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 280 | ||||
| 3uko_A | 378 | Crystal Structure Of S-Nitrosoglutathione Reductase | 3e-63 | ||
| 4dl9_A | 396 | Crystal Structure Of S-nitrosoglutathione Reductase | 4e-61 | ||
| 3qj5_A | 374 | S-Nitrosoglutathione Reductase (Gsnor) In Complex W | 1e-52 | ||
| 1mc5_A | 374 | Ternary Complex Of Human Glutathione-Dependent Form | 1e-52 | ||
| 1teh_A | 373 | Structure Of Human Liver Chichi Alcohol Dehydrogena | 2e-52 | ||
| 2fzw_A | 373 | Structure Of The Binary Complex Of The E67l Mutant | 2e-51 | ||
| 1cdo_A | 374 | Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co | 4e-48 | ||
| 1agn_A | 373 | X-Ray Structure Of Human Sigma Alcohol Dehydrogenas | 1e-47 | ||
| 1d1t_A | 373 | Mutant Of Human Sigma Alcohol Dehydrogenase With Le | 1e-47 | ||
| 3cos_A | 381 | Crystal Structure Of Human Class Ii Alcohol Dehydro | 2e-47 | ||
| 1e3l_A | 376 | P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase | 2e-45 | ||
| 3oq6_A | 374 | Horse Liver Alcohol Dehydrogenase A317c Mutant Comp | 8e-45 | ||
| 1n8k_A | 374 | Horse Liver Alcohol Dehydrogenase Val292thr Mutant | 8e-45 | ||
| 1ju9_A | 374 | Horse Liver Alcohol Dehydrogenase Val292ser Mutant | 8e-45 | ||
| 6adh_A | 374 | Structure Of Triclinic Ternary Complex Of Horse Liv | 8e-45 | ||
| 1qlh_A | 374 | Horse Liver Alcohol Dehydrogenase Complexed To Nad | 9e-45 | ||
| 1ee2_B | 373 | The Structure Of Steroid-Active Alcohol Dehydrogena | 9e-45 | ||
| 1ee2_A | 373 | The Structure Of Steroid-Active Alcohol Dehydrogena | 9e-45 | ||
| 1p0c_A | 373 | Crystal Structure Of The Nadp(H)-Dependent Vertebra | 1e-44 | ||
| 1qv6_A | 374 | Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG | 1e-44 | ||
| 1axg_A | 374 | Crystal Structure Of The Val203->ala Mutant Of Live | 2e-44 | ||
| 1e3e_A | 376 | Mouse Class Ii Alcohol Dehydrogenase Complex With N | 3e-44 | ||
| 1axe_A | 374 | Crystal Structure Of The Active-Site Mutant Phe93-> | 3e-44 | ||
| 1mgo_A | 374 | Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L | 7e-44 | ||
| 1a71_A | 374 | Ternary Complex Of An Active Site Double Mutant Of | 9e-44 | ||
| 1ht0_A | 374 | Human Gamma-2 Alcohol Dehydrogense Length = 374 | 4e-43 | ||
| 1hdy_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 7e-42 | ||
| 1hdx_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 6e-41 | ||
| 1htb_A | 374 | Crystallization Of Human Beta3 Alcohol Dehydrogenas | 7e-41 | ||
| 1hdz_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 1e-40 | ||
| 1hso_A | 374 | Human Alpha Alcohol Dehydrogenase (Adh1a) Length = | 2e-40 | ||
| 1f8f_A | 371 | Crystal Structure Of Benzyl Alcohol Dehydrogenase F | 2e-22 | ||
| 3meq_A | 365 | Crystal Structure Of Alcohol Dehydrogenase From Bru | 9e-12 | ||
| 3s1l_A | 340 | Crystal Structure Of Apo-Form Furx Length = 340 | 2e-09 | ||
| 2xaa_A | 345 | Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube | 9e-09 | ||
| 3ftn_A | 352 | Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO | 2e-08 | ||
| 1llu_A | 342 | The Ternary Complex Of Pseudomonas Aeruginosa Alcoh | 4e-08 | ||
| 1jqb_A | 351 | Alcohol Dehydrogenase From Clostridium Beijerinckii | 5e-08 | ||
| 3fsr_A | 352 | Chimera Of Alcohol Dehydrogenase By Exchange Of The | 5e-08 | ||
| 1e3j_A | 352 | Ketose Reductase (Sorbitol Dehydrogenase) From Silv | 5e-08 | ||
| 2b83_A | 351 | A Single Amino Acid Substitution In The Clostridium | 8e-08 | ||
| 1rjw_A | 339 | Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd | 9e-08 | ||
| 1ped_A | 351 | Bacterial Secondary Alcohol Dehydrogenase (Apo-Form | 1e-07 | ||
| 1y9a_A | 360 | Alcohol Dehydrogenase From Entamoeba Histolotica In | 1e-07 | ||
| 2oui_A | 360 | D275p Mutant Of Alcohol Dehydrogenase From Protozoa | 1e-07 | ||
| 3pii_A | 339 | Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog | 2e-07 | ||
| 1ykf_A | 352 | Nadp-Dependent Alcohol Dehydrogenase From Thermoana | 2e-07 | ||
| 2nvb_A | 352 | Contribution Of Pro275 To The Thermostability Of Th | 3e-07 | ||
| 3fpl_A | 351 | Chimera Of Alcohol Dehydrogenase By Exchange Of The | 8e-07 | ||
| 4a2c_A | 346 | Crystal Structure Of Galactitol-1-Phosphate Dehydro | 2e-06 | ||
| 2h6e_A | 344 | Crystal Structure Of The D-Arabinose Dehydrogenase | 3e-06 | ||
| 2eer_A | 347 | Structural Study Of Project Id St2577 From Sulfolob | 4e-06 | ||
| 3fpc_A | 352 | Chimera Of Alcohol Dehydrogenase By Exchange Of The | 4e-06 | ||
| 4ilk_A | 359 | Crystal Structure Of Short Chain Alcohol Dehydrogen | 7e-06 | ||
| 4ej6_A | 370 | Crystal Structure Of A Putative Zinc-Binding Dehydr | 3e-05 | ||
| 2dfv_A | 347 | Hyperthermophilic Threonine Dehydrogenase From Pyro | 4e-05 | ||
| 2d8a_A | 348 | Crystal Structure Of Ph0655 From Pyrococcus Horikos | 4e-05 | ||
| 1h2b_A | 359 | Crystal Structure Of The Alcohol Dehydrogenase From | 9e-05 | ||
| 2eih_A | 343 | Crystal Structure Of Nad-Dependent Alcohol Dehydrog | 1e-04 | ||
| 1vj0_A | 380 | Crystal Structure Of Alcohol Dehydrogenase (Tm0436) | 3e-04 | ||
| 3qe3_A | 355 | Sheep Liver Sorbitol Dehydrogenase Length = 355 | 4e-04 | ||
| 4eez_A | 348 | Crystal Structure Of Lactococcus Lactis Alcohol Deh | 7e-04 | ||
| 4eex_A | 348 | Crystal Structure Of Lactococcus Lactis Alcohol Deh | 8e-04 |
| >pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 | Back alignment and structure |
|
| >pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 | Back alignment and structure |
| >pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 | Back alignment and structure |
| >pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 | Back alignment and structure |
| >pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 | Back alignment and structure |
| >pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 | Back alignment and structure |
| >pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 | Back alignment and structure |
| >pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 | Back alignment and structure |
| >pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 | Back alignment and structure |
| >pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 | Back alignment and structure |
| >pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 | Back alignment and structure |
| >pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 | Back alignment and structure |
| >pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 | Back alignment and structure |
| >pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 | Back alignment and structure |
| >pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 | Back alignment and structure |
| >pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 | Back alignment and structure |
| >pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 | Back alignment and structure |
| >pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 | Back alignment and structure |
| >pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 | Back alignment and structure |
| >pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 | Back alignment and structure |
| >pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 | Back alignment and structure |
| >pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 | Back alignment and structure |
| >pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 | Back alignment and structure |
| >pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 | Back alignment and structure |
| >pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 | Back alignment and structure |
| >pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 | Back alignment and structure |
| >pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 | Back alignment and structure |
| >pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 | Back alignment and structure |
| >pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 | Back alignment and structure |
| >pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 | Back alignment and structure |
| >pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 | Back alignment and structure |
| >pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 | Back alignment and structure |
| >pdb|3FTN|A Chain A, Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDROGENASE BY EXCHANGE Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 | Back alignment and structure |
| >pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 | Back alignment and structure |
| >pdb|1JQB|A Chain A, Alcohol Dehydrogenase From Clostridium Beijerinckii: Crystal Structure Of Mutant With Enhanced Thermal Stability Length = 351 | Back alignment and structure |
| >pdb|3FSR|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 | Back alignment and structure |
| >pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 | Back alignment and structure |
| >pdb|2B83|A Chain A, A Single Amino Acid Substitution In The Clostridium Beijerinckii Alcohol Dehydrogenase Is Critical For Thermostabilization Length = 351 | Back alignment and structure |
| >pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 | Back alignment and structure |
| >pdb|1PED|A Chain A, Bacterial Secondary Alcohol Dehydrogenase (Apo-Form) Length = 351 | Back alignment and structure |
| >pdb|1Y9A|A Chain A, Alcohol Dehydrogenase From Entamoeba Histolotica In Complex With Cacodylate Length = 360 | Back alignment and structure |
| >pdb|2OUI|A Chain A, D275p Mutant Of Alcohol Dehydrogenase From Protozoa Entamoeba Histolytica Length = 360 | Back alignment and structure |
| >pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 | Back alignment and structure |
| >pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 | Back alignment and structure |
| >pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 | Back alignment and structure |
| >pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 | Back alignment and structure |
| >pdb|4A2C|A Chain A, Crystal Structure Of Galactitol-1-Phosphate Dehydrogenase From Escherichia Coli Length = 346 | Back alignment and structure |
| >pdb|2H6E|A Chain A, Crystal Structure Of The D-Arabinose Dehydrogenase From Sulfolobus Solfataricus Length = 344 | Back alignment and structure |
| >pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 | Back alignment and structure |
| >pdb|3FPC|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-294 Of T. Brockii Adh By E. Histolytica Adh Length = 352 | Back alignment and structure |
| >pdb|4ILK|A Chain A, Crystal Structure Of Short Chain Alcohol Dehydrogenase (rspb) From E. Coli Cft073 (efi Target Efi-506413) Complexed With Cofactor Nadh Length = 359 | Back alignment and structure |
| >pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 | Back alignment and structure |
| >pdb|2DFV|A Chain A, Hyperthermophilic Threonine Dehydrogenase From Pyrococcus Horikoshii Length = 347 | Back alignment and structure |
| >pdb|2D8A|A Chain A, Crystal Structure Of Ph0655 From Pyrococcus Horikoshii Ot3 Length = 348 | Back alignment and structure |
| >pdb|1H2B|A Chain A, Crystal Structure Of The Alcohol Dehydrogenase From The Hyperthermophilic Archaeon Aeropyrum Pernix At 1.65a Resolution Length = 359 | Back alignment and structure |
| >pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 | Back alignment and structure |
| >pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 | Back alignment and structure |
| >pdb|3QE3|A Chain A, Sheep Liver Sorbitol Dehydrogenase Length = 355 | Back alignment and structure |
| >pdb|4EEZ|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Variant Re1 Length = 348 | Back alignment and structure |
| >pdb|4EEX|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Length = 348 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 280 | |||
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 1e-132 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 1e-130 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 1e-130 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 1e-128 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 1e-128 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 1e-100 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 2e-90 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 1e-58 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 2e-48 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 2e-44 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 1e-43 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 2e-43 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 4e-42 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 2e-39 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 1e-38 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 3e-38 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 7e-36 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 1e-35 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 2e-35 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 6e-35 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 7e-34 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 7e-34 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 2e-33 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 2e-32 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 2e-32 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 3e-25 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 3e-24 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 1e-21 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 5e-20 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 1e-19 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 2e-19 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 5e-19 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 2e-18 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 8e-18 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 8e-17 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 8e-17 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 1e-16 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 4e-15 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 1e-14 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 6e-13 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 4e-11 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 5e-11 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 8e-11 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 1e-10 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 3e-10 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 3e-10 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 5e-10 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 4e-09 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 5e-09 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 2e-08 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 4e-08 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 8e-08 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 3e-07 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 3e-07 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 1e-06 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 9e-06 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 2e-04 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 2e-04 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 3e-04 |
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 | Back alignment and structure |
|---|
Score = 377 bits (970), Expect = e-132
Identities = 118/260 (45%), Positives = 162/260 (62%), Gaps = 2/260 (0%)
Query: 11 AGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVF 70
A + I+C+AA+A G+PL I+E+ V PP +HEVR++II T++CH+D D F
Sbjct: 1 ANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCF 60
Query: 71 PRILGHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPW 130
P ILGH G+VESVGE V + GD VIP ++ C EC C + K NLC
Sbjct: 61 PVILGHLGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKG 120
Query: 131 MPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTGV 190
+ D TSRF +G+TI H++ S+FSEYTV+ V K+DP P ++ CLL CG+STG
Sbjct: 121 LMPDGTSRFT-CKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY 179
Query: 191 GAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEF 250
GAA TA +E GS +FGLG +GLAV G ++ GA+RIIGVD+ +KF K FG TE
Sbjct: 180 GAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATEC 239
Query: 251 VNSKNCGDKSVSQVLLSIYD 270
+N ++ K + +VL+ + D
Sbjct: 240 INPQDF-SKPIQEVLIEMTD 258
|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 100.0 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 100.0 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 100.0 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 100.0 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 100.0 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 100.0 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 100.0 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 100.0 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 100.0 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 100.0 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 100.0 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 100.0 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 100.0 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 100.0 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 100.0 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 100.0 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 100.0 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 100.0 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 100.0 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 100.0 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 100.0 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 100.0 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 100.0 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 100.0 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 100.0 | |
| 4eez_A | 348 | Alcohol dehydrogenase 1; site-saturation mutagenes | 100.0 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 100.0 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 100.0 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 100.0 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 100.0 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 100.0 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 100.0 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 100.0 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 100.0 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 100.0 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 100.0 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 100.0 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 100.0 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 100.0 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 100.0 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 100.0 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 100.0 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 100.0 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 100.0 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 100.0 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 100.0 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 100.0 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 100.0 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 100.0 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 100.0 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 100.0 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 100.0 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 100.0 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 100.0 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 100.0 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 100.0 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 100.0 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 100.0 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 100.0 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 100.0 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 100.0 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 100.0 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 100.0 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 100.0 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 100.0 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 100.0 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 100.0 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 100.0 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 99.97 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 99.9 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 99.6 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 98.5 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.32 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 97.39 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 97.2 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 97.16 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 97.14 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 97.04 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 96.95 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 96.93 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.93 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.86 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 96.75 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.73 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 96.59 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 96.58 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.48 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 96.47 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 96.4 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 96.35 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 96.16 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 96.16 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.15 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 96.14 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 96.12 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 96.1 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 96.02 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 96.01 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 95.97 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 95.93 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 95.87 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 95.87 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 95.86 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 95.85 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.84 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 95.83 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.75 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 95.74 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 95.73 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 95.71 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 95.7 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 95.69 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 95.69 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 95.66 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 95.65 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 95.65 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 95.59 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 95.55 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 95.51 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 95.48 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 95.45 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 95.41 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 95.4 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 95.4 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 95.4 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 95.4 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 95.38 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 95.38 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 95.37 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 95.29 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.28 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 95.27 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.25 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 95.24 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 95.24 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.23 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 95.22 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 95.18 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 95.16 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 95.11 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 95.11 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 95.11 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 95.1 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 95.1 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 95.06 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 95.04 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 95.04 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 95.03 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 95.02 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 95.01 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 95.01 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 94.99 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 94.99 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 94.98 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 94.96 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 94.95 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 94.94 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 94.93 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 94.92 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 94.91 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 94.9 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 94.89 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 94.88 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 94.88 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 94.87 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 94.87 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 94.86 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 94.83 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 94.83 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 94.83 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 94.82 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 94.82 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 94.81 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 94.8 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 94.8 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 94.8 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 94.77 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 94.76 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 94.75 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 94.75 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 94.75 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 94.74 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 94.66 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 94.63 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 94.63 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 94.62 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 94.62 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 94.62 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 94.62 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 94.61 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 94.59 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 94.58 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 94.58 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 94.5 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 94.49 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 94.49 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.48 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 94.47 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 94.46 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 94.45 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 94.44 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 94.43 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 94.42 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 94.42 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 94.39 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 94.38 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 94.38 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 94.36 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 94.35 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 94.34 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 94.34 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.33 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 94.32 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 94.31 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 94.31 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.3 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.29 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 94.29 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 94.27 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 94.27 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 94.26 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 94.26 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 94.23 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 94.21 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 94.2 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 94.15 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 94.15 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 94.13 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 94.13 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 94.13 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 94.04 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 94.04 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 94.02 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 93.99 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 93.97 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 93.96 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 93.95 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 93.93 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 93.92 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 93.92 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 93.92 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 93.9 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 93.89 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 93.89 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 93.89 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 93.89 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 93.88 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 93.88 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 93.85 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 93.85 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 93.83 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 93.81 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 93.77 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 93.75 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 93.74 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 93.73 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 93.72 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 93.69 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 93.68 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 93.68 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 93.68 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 93.61 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 93.61 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 93.6 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 93.57 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 93.57 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 93.55 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 93.54 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 93.52 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 93.52 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 93.51 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 93.49 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 93.49 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 93.48 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 93.46 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 93.45 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 93.45 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 93.4 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 93.4 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 93.39 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 93.35 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 93.29 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 93.27 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 93.26 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 93.24 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 93.15 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 93.12 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 93.1 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 93.1 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 93.08 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 92.94 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 92.88 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 92.87 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 92.86 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 92.83 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 92.83 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 92.83 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 92.81 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 92.8 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 92.78 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 92.77 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 92.74 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 92.73 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 92.7 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 92.64 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 92.59 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 92.5 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 92.49 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 92.48 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 92.46 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 92.45 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 92.37 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 92.26 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 92.26 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 92.22 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 92.22 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 92.22 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 92.21 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 92.21 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 92.15 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 92.13 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 92.12 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 92.12 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 92.11 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 92.1 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 92.07 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 92.04 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 92.03 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 91.98 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 91.94 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 91.92 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 91.91 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 91.86 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 91.84 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 91.82 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 91.79 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 91.77 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 91.76 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 91.76 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 91.74 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 91.72 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 91.68 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 91.63 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 91.62 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 91.59 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 91.52 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 91.49 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 91.45 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 91.34 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 91.33 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 91.32 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 91.32 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 91.22 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 91.2 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 91.18 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 91.18 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 91.17 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 91.16 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 91.15 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 91.15 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 91.13 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 91.07 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 91.06 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 91.01 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 90.98 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 90.97 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 90.93 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 90.85 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 90.81 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 90.77 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 90.76 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 90.7 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 90.67 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 90.64 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 90.62 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 90.6 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 90.56 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 90.53 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 90.45 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 90.41 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 90.37 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 90.36 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 90.27 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 90.24 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 90.23 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 90.22 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 90.18 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 90.14 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 90.06 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 90.04 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 89.95 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 89.94 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 89.93 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 89.91 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 89.8 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 89.79 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 89.75 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 89.73 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 89.73 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 89.71 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 89.69 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 89.68 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 89.64 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 89.62 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 89.61 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 89.55 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 89.51 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 89.51 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 89.49 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 89.46 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 89.45 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 89.45 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 89.42 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 89.32 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 89.31 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 89.29 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 89.27 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 89.22 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 89.2 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 89.19 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 89.02 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 88.93 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 88.87 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 88.87 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 88.73 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 88.66 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 88.6 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 88.59 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 88.58 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 88.58 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 88.56 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 88.5 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 88.46 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 88.42 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 88.27 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 88.22 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 88.19 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 88.19 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 88.16 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 88.15 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 88.14 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 88.13 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 88.05 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 88.03 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 88.02 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 87.94 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 87.91 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 87.85 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 87.76 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 87.72 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 87.71 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 87.54 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 87.46 | |
| 2pqm_A | 343 | Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 | 87.37 | |
| 2v03_A | 303 | Cysteine synthase B; pyridoxal phosphate, cysteine | 87.26 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 87.17 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 87.14 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 87.1 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 86.98 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 86.87 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 86.85 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 86.84 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 86.83 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 86.83 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 86.82 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 86.8 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 86.74 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 86.68 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 86.6 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 86.57 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 86.53 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 86.41 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 86.31 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 86.3 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 86.27 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 86.25 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 86.22 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 86.21 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 86.19 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 86.17 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 86.17 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 86.14 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 86.11 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 86.11 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 86.08 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 86.07 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 86.05 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 86.05 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 86.0 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 85.99 | |
| 3tbh_A | 334 | O-acetyl serine sulfhydrylase; cysteine synthase, | 85.95 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 85.94 | |
| 1y7l_A | 316 | O-acetylserine sulfhydrylase, O-acetylserine (thio | 85.94 | |
| 3dwg_A | 325 | Cysteine synthase B; sulfur carrier protein comple | 85.93 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 85.86 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 85.77 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 85.75 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 85.68 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 85.68 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 85.67 |
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-49 Score=367.57 Aligned_cols=266 Identities=50% Similarity=0.866 Sum_probs=234.9
Q ss_pred CCCcceeeeeeecCCCCCcEEEEeecCCCCCCeEEEEeeeeecChhhhhhhhcCCCCCCCCcccccceeEEEEEeCCCCC
Q 023561 11 AGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRILGHEAIGVVESVGENVD 90 (280)
Q Consensus 11 ~~~~~~~~a~~~~~~g~~l~~~~~~~p~~~~~eVlIkv~~~~i~~~D~~~~~g~~~~~~~p~i~G~e~~G~V~~vG~~v~ 90 (280)
.+++++|||+++++++++++++++|.|+|+++||||||+++|||++|++++.|..+...+|.++|||++|+|+++|++++
T Consensus 3 ~~~~~tmkA~v~~~~~~~l~~~~~~~p~~~~~eVlVkv~a~gi~~~D~~~~~g~~~~~~~P~v~GhE~~G~V~~vG~~v~ 82 (378)
T 3uko_A 3 QGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVT 82 (378)
T ss_dssp TTSCEEEEEEEBCSTTSCCEEEEEEECCCCTTEEEEEEEEEEECHHHHHHHTTCCTTCCSSBCCCCEEEEEEEEECTTCC
T ss_pred cccceeeEEEEEecCCCccEEEEecCCCCCCCeEEEEEEEeecCHHHHHHhcCCCCCCCCCccCCccceEEEEEeCCCCC
Confidence 44678999999999998899999999999999999999999999999999999877667899999999999999999999
Q ss_pred CCCCCCEEEecCCCCCCCChhhcCCCCCCCCCCCCCcCCCCC-CCCCccccccCCceeecccccceeeeeEEeecccEEE
Q 023561 91 GVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPWMP-RDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVK 169 (280)
Q Consensus 91 ~~~~Gd~V~~~~~~~c~~c~~c~~g~~~~c~~~~~~~~~g~~-~~G~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~ 169 (280)
+|++||||++.+..+|+.|.+|+.|++++|++.......|+. .+|..+|. .+|....++.+.|+|+||++++.+.+++
T Consensus 83 ~~~vGdrV~~~~~~~Cg~C~~C~~g~~~~C~~~~~~~~~G~~~~~g~~~~~-~~g~~~~~~~~~G~~aey~~v~~~~~~~ 161 (378)
T 3uko_A 83 EVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDRKSRFS-VNGKPIYHFMGTSTFSQYTVVHDVSVAK 161 (378)
T ss_dssp SCCTTCEEEECSSCCCSSSHHHHHTSCSCCCSSHHHHTTTCCTTTSSCSEE-ETTEEEBCCTTTCCSBSEEEEEGGGEEE
T ss_pred cCCCCCEEEEecCCCCCCChhhhCcCcCcCcCcccccccccccccCccccc-cCCcccccccCCcceEeEEEechhheEE
Confidence 999999999999999999999999999999986543333433 34422232 2445555666678999999999999999
Q ss_pred cCCCCChhhhcccchhhHHHHHHHHHHcCCCCCCEEEEECccHHHHHHHHHHHHcCCCeEEEEcCChhHHHHHHHcCCcE
Q 023561 170 VDPTVPPNRACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTE 249 (280)
Q Consensus 170 iP~~ls~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlI~G~g~~G~~a~~la~~~g~~~vi~~~~~~~~~~~~~~~Ga~~ 249 (280)
+|+++++++||++++++.|||+++.+..++++|++|||+|+|++|++++|+|+.+|+++|++++++++|+++++++|+++
T Consensus 162 iP~~~~~~~aa~l~~~~~ta~~al~~~~~~~~g~~VlV~GaG~vG~~a~q~a~~~Ga~~Vi~~~~~~~~~~~a~~lGa~~ 241 (378)
T 3uko_A 162 IDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNE 241 (378)
T ss_dssp CCTTSCHHHHGGGGTHHHHHHHHHHTTTCCCTTCCEEEECCSHHHHHHHHHHHHHTCSCEEEECSCTTHHHHHHTTTCCE
T ss_pred CCCCCCHHHhhhhhhhHHHHHHHHHhhcCCCCCCEEEEECCCHHHHHHHHHHHHcCCCeEEEEcCCHHHHHHHHHcCCcE
Confidence 99999999999999999999998888899999999999999999999999999999988999999999999999999999
Q ss_pred EEcCCCCCCccHHHHHHHhcCCCceEEEe
Q 023561 250 FVNSKNCGDKSVSQVLLSIYDLPLLTISV 278 (280)
Q Consensus 250 vi~~~~~~~~~~~~~v~~~~~gg~~~v~~ 278 (280)
++|+++ .++++.+.+++++++|+|.++.
T Consensus 242 vi~~~~-~~~~~~~~i~~~~~gg~D~vid 269 (378)
T 3uko_A 242 FVNPKD-HDKPIQEVIVDLTDGGVDYSFE 269 (378)
T ss_dssp EECGGG-CSSCHHHHHHHHTTSCBSEEEE
T ss_pred EEcccc-CchhHHHHHHHhcCCCCCEEEE
Confidence 999873 1278999999999887765553
|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* | Back alignment and structure |
|---|
| >2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* | Back alignment and structure |
|---|
| >3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 280 | ||||
| d1cdoa1 | 199 | b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase | 3e-42 | |
| d1p0fa1 | 198 | b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro | 1e-37 | |
| d2fzwa1 | 197 | b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase | 3e-37 | |
| d1e3ia1 | 202 | b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase | 2e-33 | |
| d2jhfa1 | 198 | b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase | 1e-32 | |
| d1f8fa1 | 194 | b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr | 2e-22 | |
| d1llua1 | 175 | b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase | 1e-19 | |
| d1piwa1 | 192 | b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy | 2e-19 | |
| d1uufa1 | 179 | b.35.1.2 (A:3-144,A:313-349) Hypothetical protein | 3e-19 | |
| d1d1ta2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 1e-18 | |
| d1vj0a1 | 184 | b.35.1.2 (A:2-155,A:338-367) Hypothetical protein | 2e-18 | |
| d1p0fa2 | 174 | c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog | 7e-18 | |
| d1pl8a1 | 185 | b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor | 2e-17 | |
| d1e3ia2 | 174 | c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( | 2e-16 | |
| d2jhfa2 | 176 | c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( | 2e-15 | |
| d1e3ja1 | 178 | b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor | 7e-15 | |
| d1jvba1 | 177 | b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase | 8e-15 | |
| d1f8fa2 | 174 | c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { | 4e-14 | |
| d1jqba1 | 177 | b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon | 3e-13 | |
| d1kola1 | 201 | b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog | 4e-13 | |
| d2fzwa2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 1e-12 | |
| d1cdoa2 | 175 | c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga | 1e-12 | |
| d1h2ba1 | 171 | b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas | 5e-12 | |
| d1rjwa1 | 171 | b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase | 5e-12 | |
| d1jqba2 | 174 | c.2.1.1 (A:1140-1313) Bacterial secondary alcohol | 2e-06 | |
| d1kola2 | 195 | c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps | 6e-06 | |
| d1iz0a1 | 131 | b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase | 9e-06 | |
| d1vj0a2 | 182 | c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T | 4e-04 | |
| d1pl8a2 | 171 | c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh | 4e-04 | |
| d1gu7a1 | 175 | b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu | 8e-04 | |
| d1piwa2 | 168 | c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase | 0.002 |
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Alcohol dehydrogenase species: Cod (Gadus callarias) [TaxId: 8053]
Score = 141 bits (357), Expect = 3e-42
Identities = 70/199 (35%), Positives = 109/199 (54%), Gaps = 1/199 (0%)
Query: 10 TAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAV 69
T GK I+C+AA+A +PLVI+E+ VD P+++E+R++II T +CH+D+
Sbjct: 2 TVGKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDG 61
Query: 70 FPRILGHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISP 129
FP +LGHE G+VESVG V G+ VIP F++ C EC C+S K N C SP
Sbjct: 62 FPVVLGHEGAGIVESVGPGVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANESP 121
Query: 130 WMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTG 189
+ + +RF +G + F+ S+FS+YTV++ V K+DP+V + + +
Sbjct: 122 DVMSPKETRF-TCKGRKVLQFLGTSTFSQYTVVNQIAVAKIDPSVKLDEFITHRMPLESV 180
Query: 190 VGAAWRTANVEVGSTVVIF 208
A + + TV+
Sbjct: 181 NDAIDLMKHGKCIRTVLSL 199
|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 | Back information, alignment and structure |
|---|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 | Back information, alignment and structure |
|---|
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| d1cdoa1 | 199 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 100.0 | |
| d2fzwa1 | 197 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 100.0 | |
| d1f8fa1 | 194 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 100.0 | |
| d1e3ia1 | 202 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 100.0 | |
| d1e3ja1 | 178 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 100.0 | |
| d1llua1 | 175 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 100.0 | |
| d1p0fa1 | 198 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 100.0 | |
| d1h2ba1 | 171 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 100.0 | |
| d2jhfa1 | 198 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 100.0 | |
| d1vj0a1 | 184 | Hypothetical protein TM0436 {Thermotoga maritima [ | 100.0 | |
| d1pl8a1 | 185 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 100.0 | |
| d1piwa1 | 192 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 100.0 | |
| d1jqba1 | 177 | Bacterial secondary alcohol dehydrogenase {Clostri | 100.0 | |
| d1jvba1 | 177 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 100.0 | |
| d1rjwa1 | 171 | Alcohol dehydrogenase {Bacillus stearothermophilus | 100.0 | |
| d1kola1 | 201 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 100.0 | |
| d1uufa1 | 179 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.98 | |
| d1yb5a1 | 150 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 99.96 | |
| d1qora1 | 147 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.95 | |
| d1xa0a1 | 152 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.95 | |
| d1iz0a1 | 131 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.94 | |
| d1o89a1 | 146 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.92 | |
| d1tt7a1 | 162 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.91 | |
| d1gu7a1 | 175 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.91 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 99.79 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 99.77 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 99.75 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 99.75 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 99.75 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.75 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 99.74 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 99.71 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 99.71 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 99.7 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 99.69 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 99.69 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 99.69 | |
| d1v3va1 | 147 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 99.66 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 99.66 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 99.64 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 99.64 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 99.64 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 99.63 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 99.63 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 99.62 | |
| d1vj1a1 | 166 | Putative zinc-binding alcohol dehydrogenase {Mouse | 99.61 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 99.58 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 99.58 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 99.56 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 99.55 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 99.55 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 99.53 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.44 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 99.43 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 99.28 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 97.14 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 96.99 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 96.97 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 96.81 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 96.72 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 96.64 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 96.64 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 96.62 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 96.61 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 96.58 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 96.55 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.53 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 96.53 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 96.5 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 96.48 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 96.41 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 96.38 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.35 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 96.32 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 96.31 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 96.29 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 96.24 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.23 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 96.23 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 96.2 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 96.16 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 96.09 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 96.06 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 96.01 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 96.0 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 95.95 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 95.93 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 95.93 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 95.9 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 95.88 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 95.85 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 95.85 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 95.83 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 95.78 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 95.75 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 95.71 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 95.71 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 95.7 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 95.68 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 95.66 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 95.66 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 95.56 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 95.56 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 95.49 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 95.49 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 95.47 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 95.43 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 95.43 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.41 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 95.37 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 95.36 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.22 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 95.17 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 95.02 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 95.02 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 94.99 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 94.84 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 94.82 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 94.73 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 94.63 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 94.62 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 94.55 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 94.52 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 94.49 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 94.41 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 94.4 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 94.37 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 94.31 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 94.28 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 94.28 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 94.27 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 93.94 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 93.89 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 93.89 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 93.86 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 93.69 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 93.66 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 93.64 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 93.6 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 93.56 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.56 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 93.5 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 93.46 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 93.39 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 93.19 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 93.18 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 92.95 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 92.92 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 92.7 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 92.69 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 92.59 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 92.44 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 92.4 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 92.18 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 92.17 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 92.05 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 92.02 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 91.97 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 91.74 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 91.61 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 91.59 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 91.4 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 91.33 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 91.3 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 91.27 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 91.24 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 91.14 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 91.1 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 91.02 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 91.0 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 90.99 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 90.9 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 90.75 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 90.7 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 90.67 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 90.64 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 90.58 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 90.47 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 90.41 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 90.33 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 90.08 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 90.0 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 89.92 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 89.82 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 89.8 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 89.77 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 89.69 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 89.68 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 89.64 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 89.6 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 89.6 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 89.56 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 89.52 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 89.48 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 89.46 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 89.38 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 89.29 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 89.27 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 89.2 | |
| d2bhsa1 | 292 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 89.14 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 88.92 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 88.88 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 88.82 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 88.79 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 88.78 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 88.73 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 88.65 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 88.64 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 88.58 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 88.53 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 88.41 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 88.38 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 88.34 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 88.3 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 88.22 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 88.2 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 88.19 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 88.18 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 88.09 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 88.05 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 88.03 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 88.0 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 87.91 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 87.34 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 87.3 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 87.25 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 87.15 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 87.13 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 87.01 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.94 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 86.92 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 86.85 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 86.81 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 86.56 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 86.53 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 86.5 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 86.45 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 86.44 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 86.39 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 86.3 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 86.3 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 86.2 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 86.14 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 86.13 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 86.1 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 86.01 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 85.89 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 85.88 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 85.74 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 85.57 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 85.51 | |
| d1jbqa_ | 355 | Cystathionine beta-synthase {Human (Homo sapiens) | 85.41 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 85.33 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 85.17 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 84.9 | |
| d1wkva1 | 382 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 84.89 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 84.82 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 84.67 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 84.66 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 84.55 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 84.48 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 84.16 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 84.11 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 84.1 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 84.07 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 84.0 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 83.98 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 83.83 | |
| d1y7la1 | 310 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 83.67 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 83.62 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 83.4 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 83.37 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 83.32 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 83.3 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 83.13 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 83.12 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 82.97 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 82.9 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 82.75 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 82.64 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 82.61 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 82.55 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 82.34 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 82.24 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 82.19 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 81.94 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 81.9 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 81.88 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 81.62 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 81.36 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 81.22 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 81.12 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 81.12 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 81.0 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 80.64 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 80.56 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 80.37 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 80.2 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 80.14 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 80.02 |
| >d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: GroES-like superfamily: GroES-like family: Alcohol dehydrogenase-like, N-terminal domain domain: Alcohol dehydrogenase species: Cod (Gadus callarias) [TaxId: 8053]
Probab=100.00 E-value=2.9e-39 Score=271.16 Aligned_cols=196 Identities=35% Similarity=0.562 Sum_probs=178.7
Q ss_pred CCcceeeeeeecCCCCCcEEEEeecCCCCCCeEEEEeeeeecChhhhhhhhcCCCCCCCCcccccceeEEEEEeCCCCCC
Q 023561 12 GKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRILGHEAIGVVESVGENVDG 91 (280)
Q Consensus 12 ~~~~~~~a~~~~~~g~~l~~~~~~~p~~~~~eVlIkv~~~~i~~~D~~~~~g~~~~~~~p~i~G~e~~G~V~~vG~~v~~ 91 (280)
++++|+||+++.++++||+++|++.|+|+++|||||+.++|||++|++++.+......+|.++|||++|+|+++|+++.+
T Consensus 4 ~~~~~~kAav~~~~~~pl~i~ev~~P~p~~~eVlIkv~a~giCgsD~~~~~g~~~~~~~p~i~GhE~~G~v~~vG~~v~~ 83 (199)
T d1cdoa1 4 GKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVLGHEGAGIVESVGPGVTE 83 (199)
T ss_dssp TSCEEEEEEEBCSTTSCCEEEEEEECCCCTTEEEEEEEEEECCHHHHHHHHTTCCTTSCSEECCCCEEEEEEEECTTCCS
T ss_pred CCceEEEEEEEecCCCCcEEEEEECCCCCCCEEEEEEEEEEEecchhhhhhhcccccccccccccccceEEEEEcCCCce
Confidence 46789999999999999999999999999999999999999999999999998777778999999999999999999999
Q ss_pred CCCCCEEEecCCCCCCCChhhcCCCCCCCCCCCCCcCCCCCCCCCccccccCCceeecccccceeeeeEEeecccEEEcC
Q 023561 92 VVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVD 171 (280)
Q Consensus 92 ~~~Gd~V~~~~~~~c~~c~~c~~g~~~~c~~~~~~~~~g~~~~G~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~iP 171 (280)
|++||||++.+..+|++|.+|+.+++++|++.......+...+|..++ ..+|..+.++++.|+|+||++++..+++++|
T Consensus 84 ~~~GdrV~~~~~~~cg~c~~C~~g~~~~C~~~~~~~~~~~~~~~~~~~-~~~g~~~~~~~~~Ggfaey~~v~~~~~~~iP 162 (199)
T d1cdoa1 84 FQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANESPDVMSPKETRF-TCKGRKVLQFLGTSTFSQYTVVNQIAVAKID 162 (199)
T ss_dssp CCTTCEEEECSSCCCSSSHHHHCTTCCCCSCSGGGTCTTTTSCSCCCE-EETTEEEEEGGGTCCSBSEEEEEGGGEEECC
T ss_pred ecCCCEEEEeeeccccccccccCCCcccccccccccccccccCcccce-eeccceeecccccCCceEEEEEchHHEEECC
Confidence 999999999999999999999999999999988776666666664333 2466677777778999999999999999999
Q ss_pred CCCChhhhcccchhhHHHHHHHHHHcCCCCCCEEEEE
Q 023561 172 PTVPPNRACLLSCGVSTGVGAAWRTANVEVGSTVVIF 208 (280)
Q Consensus 172 ~~ls~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlI~ 208 (280)
++++++++|++.+++.|++.++......+.|++|||+
T Consensus 163 ~~~~~~~aa~l~~~l~t~~~av~~~~~~~~G~tVlv~ 199 (199)
T d1cdoa1 163 PSVKLDEFITHRMPLESVNDAIDLMKHGKCIRTVLSL 199 (199)
T ss_dssp TTSCCGGGEEEEEEGGGHHHHHHHHHTTCCSEEEEEC
T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHhCCCCCCCEEEeC
Confidence 9999999999999999999998888899999999984
|
| >d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|