Citrus Sinensis ID: 023566

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccEEEEcccEEEEEEccHHHHHHHHHcccccccccccccccHHHHHHcccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEcEEEEEccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEccccEEEEccHHHHHHHHHHccccccccccccHHHHHHHHcccEccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHEEEEccEEEc
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRmqgikgpppsilygnlpeMQKIQanaakpsstslasdivahdytstlFPYFEQWrkeygpiytystgmrqhmyvnqPELVKEMNQSIsldlgkpsyvtkrlapmlgngllrsnghcwaqqrkivapeffMDKVKGMVGIMVESTQPLLRKWQDYveaedgvnadirvDEDLREVSADVisrasfgssnlrGKEIFAKLRSLQKAISNqsflfgatnfayaclpfnhyHYIISYILIPATFVC
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADvisrasfgssnlrgKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
***ALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGI******ILYG*********************SDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFV*
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQ*****************IVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKW************DIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQ**********LASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLPFNHYHYIISYILIPATFVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q9FF18 518 Cytokinin hydroxylase OS= no no 0.864 0.467 0.294 1e-27
Q9ZW95 512 Cytokinin hydroxylase OS= no no 0.871 0.476 0.284 3e-25
O48786 520 Cytochrome P450 734A1 OS= no no 0.753 0.405 0.285 2e-20
Q69XM6 538 Cytochrome P450 734A4 OS= no no 0.760 0.395 0.274 8e-19
Q6Z6D6 557 Cytochrome P450 734A2 OS= no no 0.782 0.393 0.257 2e-17
B9X287 542 Cytochrome P450 734A6 OS= no no 0.782 0.404 0.252 3e-16
Q05047 524 Secologanin synthase OS=C N/A no 0.792 0.423 0.289 2e-15
Q8LIF2 537 Cytochrome P450 734A5 OS= no no 0.678 0.353 0.241 4e-14
Q27516 509 Putative cytochrome P450 yes no 0.457 0.251 0.284 1e-09
P14580 510 Cytochrome P450 4A6 OS=Or yes no 0.396 0.217 0.305 3e-09
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function desciption
 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 129/255 (50%), Gaps = 13/255 (5%)

Query: 6   VFNSAVALAIAFLLGHLYKTV---WLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQA 62
           +  S + + +  +L  LY T+   WL    +++ +  QG+ GP P  L GN+ E+  + +
Sbjct: 5   ILKSLLVIFVTTILRVLYDTISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVS 64

Query: 63  NAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEMN 122
            +A     S   D + HD    L P++  W K+YG  +    G    + + + EL+KE+ 
Sbjct: 65  QSA-----SKDCDSIHHDIVGRLLPHYVAWSKQYGKRFIVWNGTDPRLCLTETELIKELL 119

Query: 123 QSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVEST 182
              +   G+     +     +G GLL +NG  W  QR + AP F  +++KG    MVE T
Sbjct: 120 MKHNGVSGRSWLQQQGTKNFIGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECT 179

Query: 183 QPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQK- 241
             L+ + +   E  +G N ++ + E++ +++AD+ISR  FGSS  +GKE+F  L  LQ+ 
Sbjct: 180 SKLVERLRK--EVGEGAN-EVEIGEEMHKLTADIISRTKFGSSFEKGKELFNHLTVLQRR 236

Query: 242 -AISNQSFLFGATNF 255
            A + +   F  + F
Sbjct: 237 CAQATRHLCFPGSRF 251
Cytokinin hydroxylase that catalyzes the biosynthesis of trans-zeatin via the isopentenyladenine riboside 5'-monophosphate (iPRMP)-dependent pathway. Can use isopentenyladenosine-5'-monophosphate, isopentenyladenosine-5'-diphosphate and isopentenyladenosine-5'-triphosphate as substrate.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 Back     alignment and function description
>sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
224127989 482 cytochrome P450 [Populus trichocarpa] gi 0.778 0.452 0.753 1e-97
225448341 525 PREDICTED: cytochrome P450 734A1 [Vitis 0.903 0.481 0.657 6e-96
255548610 523 cytochrome P450, putative [Ricinus commu 0.903 0.483 0.628 2e-93
356509114 532 PREDICTED: LOW QUALITY PROTEIN: cytokini 0.892 0.469 0.610 7e-89
356516202 532 PREDICTED: cytochrome P450 734A1-like [G 0.892 0.469 0.606 8e-89
357464343 524 Cytochrome P450 [Medicago truncatula] gi 0.903 0.482 0.567 2e-86
255550874 512 cytochrome P450, putative [Ricinus commu 0.892 0.488 0.551 3e-79
18420859 532 cytochrome P450, family 714, subfamily A 0.914 0.481 0.554 3e-78
449457460 529 PREDICTED: cytokinin hydroxylase-like [C 0.889 0.470 0.582 2e-77
449491696 529 PREDICTED: LOW QUALITY PROTEIN: cytokini 0.889 0.470 0.578 8e-77
>gi|224127989|ref|XP_002329227.1| cytochrome P450 [Populus trichocarpa] gi|222871008|gb|EEF08139.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 194/219 (88%), Gaps = 1/219 (0%)

Query: 39  MQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGP 98
           MQGI+GPPPS LYGNLPEMQKIQ N  K SS   A D +AHDYTST+FPYFEQWRKEYGP
Sbjct: 1   MQGIQGPPPSFLYGNLPEMQKIQLNTLKASSFQ-APDFIAHDYTSTVFPYFEQWRKEYGP 59

Query: 99  IYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQ 158
           +YTYSTG+RQH+YVNQPELVKEMNQ ISLDLGKPSY+TKR+AP+LGNG++RSNG  WAQQ
Sbjct: 60  VYTYSTGLRQHLYVNQPELVKEMNQMISLDLGKPSYLTKRMAPLLGNGIVRSNGLVWAQQ 119

Query: 159 RKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVIS 218
           RKIVAPEF+MDKVKGMVG+MVES QPLL+KW++ +EA+ G+ AD++VDEDLRE+SA+VIS
Sbjct: 120 RKIVAPEFYMDKVKGMVGLMVESAQPLLKKWEECIEAQGGITADVKVDEDLRELSANVIS 179

Query: 219 RASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAY 257
           RA FGSS  +GK+IF+KLRSLQ+  SNQ+ LFG TNF +
Sbjct: 180 RACFGSSYSKGKQIFSKLRSLQQTFSNQNILFGVTNFGF 218

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225448341|ref|XP_002266768.1| PREDICTED: cytochrome P450 734A1 [Vitis vinifera] gi|297736650|emb|CBI25521.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548610|ref|XP_002515361.1| cytochrome P450, putative [Ricinus communis] gi|223545305|gb|EEF46810.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356509114|ref|XP_003523297.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin hydroxylase-like [Glycine max] Back     alignment and taxonomy information
>gi|356516202|ref|XP_003526785.1| PREDICTED: cytochrome P450 734A1-like [Glycine max] Back     alignment and taxonomy information
>gi|357464343|ref|XP_003602453.1| Cytochrome P450 [Medicago truncatula] gi|355491501|gb|AES72704.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255550874|ref|XP_002516485.1| cytochrome P450, putative [Ricinus communis] gi|223544305|gb|EEF45826.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18420859|ref|NP_568463.1| cytochrome P450, family 714, subfamily A, polypeptide 1 [Arabidopsis thaliana] gi|16604324|gb|AAL24168.1| AT5g24910/F6A4_120 [Arabidopsis thaliana] gi|27363368|gb|AAO11603.1| At5g24910/F6A4_120 [Arabidopsis thaliana] gi|332005994|gb|AED93377.1| cytochrome P450, family 714, subfamily A, polypeptide 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449457460|ref|XP_004146466.1| PREDICTED: cytokinin hydroxylase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449491696|ref|XP_004158976.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin hydroxylase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2149438 532 CYP714A1 "cytochrome P450, fam 0.910 0.479 0.556 3.6e-73
TAIR|locus:2149423 525 CYP714A2 "cytochrome P450, fam 0.896 0.478 0.507 2.2e-66
UNIPROTKB|Q5KQH7 577 OSJNBa0095J22.13 "Os05g0482400 0.735 0.357 0.448 3.4e-45
TAIR|locus:2156672 519 CYP715A1 ""cytochrome P450, fa 0.864 0.466 0.291 2e-30
TAIR|locus:2177411 518 CYP735A1 "cytochrome P450, fam 0.864 0.467 0.298 2.4e-27
TAIR|locus:2033656 512 CYP735A2 "cytochrome P450, fam 0.871 0.476 0.288 1.3e-26
TAIR|locus:2041399 572 CYP709B2 ""cytochrome P450, fa 0.789 0.386 0.313 7.6e-26
TAIR|locus:2137697 518 CYP709B3 ""cytochrome P450, fa 0.857 0.463 0.284 1.1e-23
TAIR|locus:2041389 519 CYP709B1 ""cytochrome P450, fa 0.725 0.391 0.301 1.8e-23
TAIR|locus:2043823 520 BAS1 "PHYB ACTIVATION TAGGED S 0.803 0.432 0.279 3.7e-21
TAIR|locus:2149438 CYP714A1 "cytochrome P450, family 714, subfamily A, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 739 (265.2 bits), Expect = 3.6e-73, P = 3.6e-73
 Identities = 142/255 (55%), Positives = 186/255 (72%)

Query:     1 MEAALVFNSAVALAIAFLLGHLYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKI 60
             +E A   +  V + +  L   +Y  V  +   MRR+L MQG+KGPPPS+  GN+PEMQKI
Sbjct:     6 VEMAKTISWIVVIGVLGLGIRVYGKVMAEQWRMRRKLTMQGVKGPPPSLFRGNVPEMQKI 65

Query:    61 QANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKE 120
             Q+     S      +I+AHDYTS+LFPY + WRK+YG +YTYSTG++QH+Y+N PELVKE
Sbjct:    66 QSQIMSNSKHYSGDNIIAHDYTSSLFPYLDHWRKQYGRVYTYSTGVKQHLYMNHPELVKE 125

Query:   121 MNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVE 180
             +NQ+ +L+LGK SYVTKRL  +LG G++ SNG  WA QR+I+APEFF+DKVKGMVG++VE
Sbjct:   126 LNQANTLNLGKVSYVTKRLKSILGRGVITSNGPHWAHQRRIIAPEFFLDKVKGMVGLVVE 185

Query:   181 STQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQ 240
             S  P+L KW++ ++ E  +  DI VDEDLR  SADVISRA FGSS  +GKEIF+KLR LQ
Sbjct:   186 SAMPMLSKWEEMMKREGEMVCDIIVDEDLRAASADVISRACFGSSFSKGKEIFSKLRCLQ 245

Query:   241 KAISNQSFLFGATNF 255
             KAI++ + LF    F
Sbjct:   246 KAITHNNILFSLNGF 260
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016132 "brassinosteroid biosynthetic process" evidence=RCA
TAIR|locus:2149423 CYP714A2 "cytochrome P450, family 714, subfamily A, polypeptide 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5KQH7 OSJNBa0095J22.13 "Os05g0482400 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2156672 CYP715A1 ""cytochrome P450, family 715, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177411 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033656 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041399 CYP709B2 ""cytochrome P450, family 709, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137697 CYP709B3 ""cytochrome P450, family 709, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041389 CYP709B1 ""cytochrome P450, family 709, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-38
pfam00067 461 pfam00067, p450, Cytochrome P450 7e-17
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 3e-06
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-05
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 8e-04
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 0.001
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 0.002
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 0.004
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score =  140 bits (355), Expect = 2e-38
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 11/240 (4%)

Query: 5   LVFNSAVALAIAFLLGHLYKTV---WLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQ 61
           +V    + + +  LL   Y T+   +L    +++ +  QG++GP P  L GN+ ++  + 
Sbjct: 4   VVLKVLLVIFLTLLLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALV 63

Query: 62  ANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVKEM 121
           +      STS   D + HD    L P++  W K+YG  + Y  G    + + + EL+KE+
Sbjct: 64  SQ-----STSKDMDSIHHDIVGRLLPHYVAWSKQYGKRFIYWNGTEPRLCLTETELIKEL 118

Query: 122 NQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVES 181
               +   GK     +     +G GLL +NG  W  QR I AP F  D++KG  G MVE 
Sbjct: 119 LTKYNTVTGKSWLQQQGTKHFIGRGLLMANGADWYHQRHIAAPAFMGDRLKGYAGHMVEC 178

Query: 182 TQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQK 241
           T+ +L+  Q     E G   ++ + E +  ++AD+ISR  F SS  +GK+IF  L  LQ+
Sbjct: 179 TKQMLQSLQK--AVESGQT-EVEIGEYMTRLTADIISRTEFDSSYEKGKQIFHLLTVLQR 235

Length = 516
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
PLN02290 516 cytokinin trans-hydroxylase 99.96
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.95
PTZ00404 482 cytochrome P450; Provisional 99.94
PLN02183 516 ferulate 5-hydroxylase 99.92
PLN02687 517 flavonoid 3'-monooxygenase 99.92
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.92
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.92
PLN03112 514 cytochrome P450 family protein; Provisional 99.92
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.92
PLN03234 499 cytochrome P450 83B1; Provisional 99.91
PLN02971 543 tryptophan N-hydroxylase 99.9
PLN02394 503 trans-cinnamate 4-monooxygenase 99.9
PLN00168 519 Cytochrome P450; Provisional 99.9
PLN02966 502 cytochrome P450 83A1 99.89
PLN02500 490 cytochrome P450 90B1 99.89
PLN02655 466 ent-kaurene oxidase 99.89
PLN02196 463 abscisic acid 8'-hydroxylase 99.89
PLN02738 633 carotene beta-ring hydroxylase 99.88
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.87
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.87
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.87
PLN02774 463 brassinosteroid-6-oxidase 99.86
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.85
PLN02302 490 ent-kaurenoic acid oxidase 99.85
PLN02936 489 epsilon-ring hydroxylase 99.84
PLN03018 534 homomethionine N-hydroxylase 99.83
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.81
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.8
PLN02648 480 allene oxide synthase 99.76
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.75
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.56
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.25
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information 
Probab=99.96  E-value=4.2e-28  Score=221.84  Aligned_cols=232  Identities=28%  Similarity=0.503  Sum_probs=170.0

Q ss_pred             HHHHHHhhhHHHHHHHHhcCCCCCCCCccCCChHHHHHHHhhcCCCCCCcccccccccccccChHHHHHHHHHHhCCeeE
Q 023566           22 LYKTVWLKCETMRRRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYT  101 (280)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~~~~Pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~v~~  101 (280)
                      .+..+++.+++...+++++++|||+++|++||++.+.......+.  .+.++   ..++..+.....+.+|+++|||+++
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~PGP~~~P~iGnl~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~~~~~~yG~i~~   98 (516)
T PLN02290         24 TISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTS--KDMDS---IHHDIVGRLLPHYVAWSKQYGKRFI   98 (516)
T ss_pred             HHHHHhccHHHHHHHHHHcCCCCCCCCcCCCCHHHHHHHHHHhhc--CCCCC---CCcccccccchHHHHHHHHhCCeEE
Confidence            344566778888888899999999999999999988653222110  00000   0122223344567889999999999


Q ss_pred             EeeCCeeeEEECCHHHHHHHHhcCccCCCCChhhhhhccccccccccccCCchHHHHHhhhcCCCChhHHhhHHHHHHHH
Q 023566          102 YSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVES  181 (280)
Q Consensus       102 ~~~g~~~~v~v~~p~~i~~il~~~~~~~~k~~~~~~~~~~~~g~~i~~~~g~~w~~~R~~l~~~f~~~~l~~~~~~~~~~  181 (280)
                      +|+|+.++|+++||+++++++.++...+.++...........|+|+++++|+.|+++|+++++.|++++++.+.+.+.++
T Consensus        99 ~~~g~~~~vvv~dp~~v~~il~~~~~~~~r~~~~~~~~~~~~g~~l~~~~g~~Wk~~Rk~~~~~f~~~~l~~~~~~i~~~  178 (516)
T PLN02290         99 YWNGTEPRLCLTETELIKELLTKYNTVTGKSWLQQQGTKHFIGRGLLMANGADWYHQRHIAAPAFMGDRLKGYAGHMVEC  178 (516)
T ss_pred             EccCCccEEEECCHHHHHHHHhcCCCCCCCcchhhhHHHHHhcCCccccCchHHHHHHhhcccccCHHHHHHHHHHHHHH
Confidence            99999999999999999999998533335543222222334578899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhHhcCCcceeeehHHHHHHHHHHHHHHHHcCCCCCchhHHHHHHHHHHHHhhhhhhhccCCCcccccCC
Q 023566          182 TQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADVISRASFGSSNLRGKEIFAKLRSLQKAISNQSFLFGATNFAYACLP  261 (280)
Q Consensus       182 ~~~ll~~l~~~~~~~~~~~~~vd~~~~~~~~~~dii~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~lp~~  261 (280)
                      ++++++.|.+.... ++  +++|+.+.++.+++|++++++||.+++..++....++.+............+|+++++|..
T Consensus       179 ~~~l~~~l~~~~~~-~~--~~vd~~~~~~~~~~~vi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~p~~  255 (516)
T PLN02290        179 TKQMLQSLQKAVES-GQ--TEVEIGEYMTRLTADIISRTEFDSSYEKGKQIFHLLTVLQRLCAQATRHLCFPGSRFFPSK  255 (516)
T ss_pred             HHHHHHHHHHHHhc-CC--ceEEhHHHHHHHHHHHHHHHHcCCccccchHHHHHHHHHHHHHHHhhhhhcCchhhhCCCh
Confidence            99999999875432 33  5899999999999999999999998866555555555544433332222346666677754

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
4duf_A 471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-05
4duc_A 472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 2e-05
4dud_A 471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 2e-05
2uwh_A 458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-05
3npl_A 470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-05
4du2_B 470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 3e-05
1yqo_A 455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-05
1yqp_A 455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 5e-05
1p0x_A 455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-05
1p0w_A 455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-05
2bmh_A 455 Modeling Protein-Substrate Interactions In The Heme 5e-05
1p0v_A 455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-05
4dtw_B 469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-05
1jme_A 455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 6e-05
3ekb_A 470 Crystal Structure Of The A264c Mutant Heme Domain O 6e-05
1bvy_A 458 Complex Of The Heme And Fmn-Binding Domains Of The 6e-05
4dua_A 471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 6e-05
1jpz_A 473 Crystal Structure Of A Complex Of The Heme Domain O 6e-05
1zo4_A 473 Crystal Structure Of A328s Mutant Of The Heme Domai 6e-05
1zoa_A 473 Crystal Structure Of A328v Mutant Of The Heme Domai 6e-05
1fah_A 471 Structure Of Cytochrome P450 Length = 471 6e-05
2hpd_A 471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 6e-05
2nnb_A 471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 6e-05
1smi_A 471 A Single Mutation Of P450 Bm3 Induces The Conformat 7e-05
4dub_A 472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 7e-05
2ij2_A 470 Atomic Structure Of The Heme Domain Of Flavocytochr 7e-05
3ben_A 470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 7e-05
3kx4_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-05
2ij3_A 470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 7e-05
2ij4_A 470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 7e-05
3kx5_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-05
3ekf_A 470 Crystal Structure Of The A264q Heme Domain Of Cytoc 7e-05
3hf2_A 482 Crystal Structure Of The I401p Mutant Of Cytochrome 7e-05
3m4v_A 482 Crystal Structure Of The A330p Mutant Of Cytochrome 7e-05
3ekd_A 470 Crystal Structure Of The A264m Heme Domain Of Cytoc 7e-05
3psx_A 487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 8e-05
3dgi_A 461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 9e-05
2x7y_A 455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-04
3cbd_A 455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-04
3qi8_B 472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-04
3kx3_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-04
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 57/133 (42%), Gaps = 12/133 (9%)
Query: 95  EYGPIYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRSNGH- 153
           E G I+ +    R   Y++   L+KE       D    S   K +    G+GLL S  H 
Sbjct: 35  ELGEIFKFEAPGRVTCYLSSQRLIKEACDESRFD-KNLSQALKFVRDFAGDGLLTSWTHE 93
Query: 154 -CWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNAD--IRVDEDLR 210
             W +   I+ P F    +KG   +MV+    L++KW+        +NAD  I V ED+ 
Sbjct: 94  KNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWE-------RLNADEHIEVPEDMT 146
Query: 211 EVSADVISRASFG 223
            ++ D I    F 
Sbjct: 147 RLTLDTIGLCGFN 159
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 7e-35
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-34
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-27
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-25
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-24
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-23
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-21
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 7e-19
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-18
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 3e-17
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-16
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-14
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-13
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 4e-13
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 5e-11
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-09
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 7e-08
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-06
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 7e-06
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 7e-06
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 7e-06
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-06
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-05
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-05
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-05
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-04
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-04
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-04
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
 Score =  129 bits (327), Expect = 7e-35
 Identities = 37/189 (19%), Positives = 62/189 (32%), Gaps = 31/189 (16%)

Query: 39  MQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGP 98
           ++ +  P       NLP +                                 +   E G 
Sbjct: 2   IKEMPQPKTFGELKNLPLLNT-----------------------DKPVQALMKIADELGE 38

Query: 99  IYTYSTGMRQHMYVNQPELVKEMNQSISLDLGKPSYVTKRLAPMLGNGLLRS--NGHCWA 156
           I+ +    R   Y++   L+KE       D    S   K +    G+GL  S  +   W 
Sbjct: 39  IFKFEAPGRVTRYLSSQRLIKEACDESRFDKNL-SQALKFVRDFAGDGLFTSWTHEKNWK 97

Query: 157 QQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSADV 216
           +   I+ P F    +KG   +MV+    L++KW+         +  I V ED+  ++ D 
Sbjct: 98  KAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNA-----DEHIEVPEDMTRLTLDT 152

Query: 217 ISRASFGSS 225
           I    F   
Sbjct: 153 IGLCGFNYR 161
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.93
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.92
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.91
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.9
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.9
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.89
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.89
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.89
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.88
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.88
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.88
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.88
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.88
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.87
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.87
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.87
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.86
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.86
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.86
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.85
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.84
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.84
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.82
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.8
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.79
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.78
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.77
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.73
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.73
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.72
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.72
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.72
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.7
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.69
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.69
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.68
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.66
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.65
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.65
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.65
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.65
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.65
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.64
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.64
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.64
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.64
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.63
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.63
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.62
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.62
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.62
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.61
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.61
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.6
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.6
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.59
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.59
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.59
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.59
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.59
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.55
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.54
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.53
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.53
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.52
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.5
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.49
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.48
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.47
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.47
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.46
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.4
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.39
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.33
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.23
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.01
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.19
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.93  E-value=5.9e-25  Score=198.08  Aligned_cols=164  Identities=20%  Similarity=0.357  Sum_probs=139.6

Q ss_pred             HHHHhcCCCCCCCCccCCChHHHHHHHhhcCCCCCCcccccccccccccChHHHHHHHHHHhCCeeEEeeCCeeeEEECC
Q 023566           35 RRLRMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQ  114 (280)
Q Consensus        35 ~~~~~~~~Pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~v~~~~~g~~~~v~v~~  114 (280)
                      ++++++++|||+++|++||++.+.+                        ++..++.+++++|||++++++|+.++|+++|
T Consensus         9 ~~~k~~~~PGP~~~PliGn~~~~~~------------------------~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~d   64 (485)
T 3nxu_A            9 GLFKKLGIPGPTPLPFLGNILSYHK------------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITD   64 (485)
T ss_dssp             THHHHHTCCCCCCBTTTBTGGGGGG------------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECC
T ss_pred             hHHhhCCCCCCCCcCeecCcHHhhc------------------------ChHHHHHHHHHHcCCeEEEEeCCCCEEEECC
Confidence            4566789999999999999988755                        5567889999999999999999999999999


Q ss_pred             HHHHHHHHhcC-ccCCCCChhhhhhccccccccccccCCchHHHHHhhhcCCCChhHHhhHHHHHHHHHHHHHHHHHHHh
Q 023566          115 PELVKEMNQSI-SLDLGKPSYVTKRLAPMLGNGLLRSNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYV  193 (280)
Q Consensus       115 p~~i~~il~~~-~~~~~k~~~~~~~~~~~~g~~i~~~~g~~w~~~R~~l~~~f~~~~l~~~~~~~~~~~~~ll~~l~~~~  193 (280)
                      |+++++||.++ ...|.....+.  .....+.++++.+|+.|+++|++++++|+++.++.+.+.++++++++++.+.+..
T Consensus        65 p~~i~~il~~~~~~~f~~r~~~~--~~~~~~~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~  142 (485)
T 3nxu_A           65 PDMIKTVLVKECYSVFTNRRPFG--PVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREA  142 (485)
T ss_dssp             HHHHHHHHTTTTTTTCCCCCCCS--CCGGGGGSTTTCCHHHHHHHHHHHGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhccchhhccCCcccc--cccccccCccccCCcHHHHHHhhcChhcCHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999885 45563322111  1224567888899999999999999999999999999999999999999998754


Q ss_pred             HhcCCcceeeehHHHHHHHHHHHHHHHHcCCCCCc
Q 023566          194 EAEDGVNADIRVDEDLREVSADVISRASFGSSNLR  228 (280)
Q Consensus       194 ~~~~~~~~~vd~~~~~~~~~~dii~~~~fG~~~~~  228 (280)
                      .. +   +++|+.+.+..+++|+++.++||.+++.
T Consensus       143 ~~-g---~~~d~~~~~~~~~~dvi~~~~fG~~~~~  173 (485)
T 3nxu_A          143 ET-G---KPVTLKDVFGAYSMDVITSTSFGVNIDS  173 (485)
T ss_dssp             HH-T---CCEEHHHHHHHHHHHHHHHHHHSCCCCG
T ss_pred             cc-C---CcCcHHHHHHHHHHHHHHHHHcCCcccc
Confidence            32 4   6899999999999999999999998853
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 6e-17
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-15
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-14
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 5e-13
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-12
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-12
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-11
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-10
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-07
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-05
d1gwia_ 403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 7e-04
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 78.2 bits (191), Expect = 6e-17
 Identities = 34/188 (18%), Positives = 70/188 (37%), Gaps = 33/188 (17%)

Query: 38  RMQGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYG 97
           +  GI GP P    GN+    K                            +  +  K+YG
Sbjct: 7   KKLGIPGPTPLPFLGNILSYHK------------------------GFCMFDMECHKKYG 42

Query: 98  PIYTYSTGMRQHMYVNQPELVKEM--NQSISLDLGKPSYVTKRLAPMLGNGLLRSNGHCW 155
            ++ +  G +  + +  P+++K +   +  S+   +  +        + + +  +    W
Sbjct: 43  KVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF---MKSAISIAEDEEW 99

Query: 156 AQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAEDGVNADIRVDEDLREVSAD 215
            + R +++P F   K+K MV I+ +    L+R  +   E        + + +     S D
Sbjct: 100 KRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAE----TGKPVTLKDVFGAYSMD 155

Query: 216 VISRASFG 223
           VI+  SFG
Sbjct: 156 VITSTSFG 163
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.92
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.92
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.86
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.85
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.83
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.82
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.8
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.71
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.61
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.57
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.53
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.5
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.41
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.34
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.26
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.23
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.18
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.16
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.1
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.94
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.65
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.92  E-value=5.3e-25  Score=194.58  Aligned_cols=159  Identities=22%  Similarity=0.382  Sum_probs=135.8

Q ss_pred             cCCCCCCCCccCCChHHHHHHHhhcCCCCCCcccccccccccccChHHHHHHHHHHhCCeeEEeeCCeeeEEECCHHHHH
Q 023566           40 QGIKGPPPSILYGNLPEMQKIQANAAKPSSTSLASDIVAHDYTSTLFPYFEQWRKEYGPIYTYSTGMRQHMYVNQPELVK  119 (280)
Q Consensus        40 ~~~Pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~v~~~~~g~~~~v~v~~p~~i~  119 (280)
                      +.+|||+++|++||++.+..                       ++++.++.+++++|||||++++|+.++|+++||++++
T Consensus         1 r~iPGP~~~p~lG~l~~l~~-----------------------~~~~~~~~~~~~kyG~if~~~~~~~~~vvl~~~~~i~   57 (453)
T d2ij2a1           1 KEMPQPKTFGELKNLPLLNT-----------------------DKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIK   57 (453)
T ss_dssp             CCCCCCCCCGGGTTGGGGCS-----------------------SCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHH
T ss_pred             CCCccCCCcchhhCHHHhCC-----------------------CCHHHHHHHHHHHhCCEEEEEeCCceEEEECCHHHHH
Confidence            47899999999999987644                       3678899999999999999999999999999999999


Q ss_pred             HHHhcCccCCCCChhhhhhccccccccccc--cCCchHHHHHhhhcCCCChhHHhhHHHHHHHHHHHHHHHHHHHhHhcC
Q 023566          120 EMNQSISLDLGKPSYVTKRLAPMLGNGLLR--SNGHCWAQQRKIVAPEFFMDKVKGMVGIMVESTQPLLRKWQDYVEAED  197 (280)
Q Consensus       120 ~il~~~~~~~~k~~~~~~~~~~~~g~~i~~--~~g~~w~~~R~~l~~~f~~~~l~~~~~~~~~~~~~ll~~l~~~~~~~~  197 (280)
                      +++.++...+..... ...+..+.|+|+++  .+|++|+++|+++.+.|++++++.+.+.+.++++++++.|.+.   .+
T Consensus        58 ~v~~~~~~~~~~~~~-~~~~~~~~g~~~~~~~~~g~~wk~~Rk~l~~~fs~~~l~~~~~~i~~~~~~li~~l~~~---~~  133 (453)
T d2ij2a1          58 EACDESRFDKNLSQA-LKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERL---NA  133 (453)
T ss_dssp             HHTCTTTEEECCCHH-HHHHHHHHTTSGGGSCTTSHHHHHHHHHHGGGGSTTTHHHHHHHHHHHHHHHHHHHHTC---CT
T ss_pred             HHHhcCCcccccccH-hHHHHHhcCCcEEecCCChHHHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHhhhc---CC
Confidence            999875555544433 23345567888875  4799999999999999999999999999999999999999752   13


Q ss_pred             CcceeeehHHHHHHHHHHHHHHHHcCCCCC
Q 023566          198 GVNADIRVDEDLREVSADVISRASFGSSNL  227 (280)
Q Consensus       198 ~~~~~vd~~~~~~~~~~dii~~~~fG~~~~  227 (280)
                      +  +.+|+.+.+..+++|++++++||.+++
T Consensus       134 ~--~~idl~~~~~~~~~~~i~~~~fG~~~~  161 (453)
T d2ij2a1         134 D--EHIEVPEDMTRLTLDTIGLCGFNYRFN  161 (453)
T ss_dssp             T--CCEEHHHHHHHHHHHHHHHHHHSCCCC
T ss_pred             C--CccchHHHHHHHhhhcchhcccccccc
Confidence            3  689999999999999999999998873
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure